KEGG   Arthrobacter sp. Rue61a: ARUE_c34910Help
Entry
ARUE_c34910       CDS       T02215                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00010  Glycolysis / Gluconeogenesis
arr00620  Pyruvate metabolism
arr00640  Propanoate metabolism
arr00680  Methane metabolism
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01130  Biosynthesis of antibiotics
arr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c34910 (acsA)
   00620 Pyruvate metabolism
    ARUE_c34910 (acsA)
   00640 Propanoate metabolism
    ARUE_c34910 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ARUE_c34910 (acsA)
Enzymes [BR:arr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ARUE_c34910 (acsA)
Lipid biosynthesis proteins [BR:arr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ARUE_c34910 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFR30372
UniProt: J7LXT1
Position
3839713..3841773
Genome map
AA seq 686 aa AA seqDB search
MMRFTMSQDTTGSTATAAASTAQNGQAPHVEALENLLHENRKFAPSAEFAANAVTSADAY
AEAEADRPAFWAKQARELLTWDKDFTEALDWSNPPFAKWFVGGEINAAYNALDRHVENGL
GDRVAIYFEGEPGDTRTYTYAELTEGVKKAANAFETLGVAKGDRVAVYLPMIPEAVITLL
ACARIGAVHSVVFGGFSADALRSRIEDAEAKLVVTADGTYRRGKPSALKPAVDEALSKEG
HTVQNVVVVKRNGEDVNWVEGRDLWWSDTVDKADTEHTAVGHDSEHPLFILYTSGTTGKP
KGILHTTGGYLTQGAYTHKAVFDLHPETDVYWCTADVGWVTGHSYVTYAPLINGATQVMY
EGTPDSPHQGRWWEIVEKYKVSILYTAPTAIRTFMKWGRDIPDKYDLSSIRVLGSVGESI
NPEAWMWYRDVIGANAGKNGEKKDNPAPIVDTWWQTETGAQMIAPLPGVTATKPGSAQVP
LPGIAVDVVDEAGQSVANGEGGYLVVREPWPSMLRGIWGDPERFKDTYWSRFEAMYFAGD
GAKKDEDGDVWLLGRVDDVMNVSGHRLSTTEIESALVSHPSVAEAAVVGAADETTGQAVV
AFVILRGDAVNNGDETVLALRNHVGKEIGPIAKPKQLLIVPELPKTRSGKIVRRLLKDIA
EGRDTGDATTLADPGIMTQIAESLRK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggttcaccatgtcccaggacaccaccggatccacggccaccgctgcagcttca
acggctcagaacggtcaggccccacacgtcgaggcgcttgaaaacctcctccacgagaac
cgcaaattcgcaccgtcggcggagtttgccgccaatgcggtgacgagtgctgacgcctat
gcagaggcggaggcggaccgtcccgcgttctgggccaagcaagcccgtgagctgctgacg
tgggataaggacttcaccgaggcccttgactggtccaacccgccgttcgccaagtggttc
gtgggcggcgagatcaacgctgcgtacaacgcgctggaccggcacgtggagaacggcctg
ggcgaccgtgttgccatctacttcgaaggcgaacccggcgacacccgcacctacacctat
gccgagctgaccgaaggggtcaagaaagccgccaacgccttcgaaaccctcggtgtcgcc
aagggcgaccgcgtggccgtgtacctgcccatgatccccgaagccgtcatcacgctcctt
gcctgcgccaggatcggcgccgtgcactcggtggtgtttggtggcttctccgcggacgcg
ctgcgttcccgtatcgaggacgccgaggcaaagctcgttgtcactgccgacggcacctac
cgccgcggcaagcccagcgccctgaagcccgcggtggacgaagccctctcgaaagaaggc
cacaccgtccagaacgtggtcgtagtcaagcgcaacggcgaggacgtcaactgggtggaa
ggccgcgacctctggtggtccgacacggtagataaagcggacaccgagcacaccgccgtc
gggcatgactccgagcacccgctgttcatcctctacacctccggcaccaccggcaagccc
aagggcatcctgcacaccaccggcggctacctcacccagggtgcctacacccacaaagcc
gtgttcgacctccacccggaaaccgacgtgtactggtgcaccgccgacgtcggatgggtc
accggccactcctacgtcacctacgcaccgctcatcaacggcgccacccaggtcatgtac
gaaggcaccccggactccccgcaccagggccgctggtgggaaatcgtggagaagtacaag
gtctccatcctctacaccgcgcccactgcgatccggacgttcatgaagtggggccgggac
atcccggacaagtacgacctctcctccatccgcgtcctcggctcggtgggcgaatccatc
aaccccgaagcgtggatgtggtaccgggacgtcatcggcgccaacgccggtaagaacggc
gaaaagaaagacaaccccgccccgatcgtggacacctggtggcagaccgaaaccggcgcg
cagatgatcgccccgctgcccggcgtcacggccaccaagcccggctcggcgcaggttccg
ctgccaggcatcgccgtggacgtggtggacgaagccggccagtccgtggccaacggcgaa
ggcggttacctggtggtccgcgaaccgtggccctccatgctgcgcggtatctggggcgac
ccggagcggttcaaggacacctactggtccaggttcgaggccatgtacttcgccggcgac
ggtgccaagaaggacgaagacggcgacgtctggctcctgggccgcgtggacgacgtcatg
aacgtctcaggccaccgcctctccaccaccgaaatcgagtccgcgctggtcagccacccg
tccgtcgctgaagcggcagtggtgggtgccgctgacgagaccaccggacaggccgtcgtg
gcgttcgtcatcctccgcggtgacgccgtgaacaacggcgacgaaaccgtgctggcactg
agaaaccacgtgggcaaggaaatcgggccgatcgccaagcccaagcagctgctgatcgtt
ccggaactgcccaagacccgctcgggcaagatcgtccgccgcctcctcaaggacatcgcg
gaaggccgcgacaccggcgacgccaccaccctggccgaccccggtatcatgacgcagatc
gctgaatcactccgtaagtaa

DBGET integrated database retrieval system