KEGG   Arthrobacter sp. Rue61a: ARUE_c35000Help
Entry
ARUE_c35000       CDS       T02215                                 

Gene name
rafA
Definition
alpha-galactosidase RafA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARUE_c35000 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARUE_c35000 (rafA)
   00600 Sphingolipid metabolism
    ARUE_c35000 (rafA)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ARUE_c35000 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3850885..3853056
Genome map
AA seq 723 aa AA seqDB search
MHPLHLRSAGTSLVISTHRGEAEIAHWGADLGDTLPDLAILNEPIPPSSIDANVPAGLLP
QASSSWQGRPGLRGHRFTDGVPGFDFSVRLRVVSATSDGTTAVIVQADPDAGITVTSNLT
LHPGGLLEVKHSATNHGTSPFQVDELATMLPVAPDAVELLDLTGRWCRERHPQRRAIQQG
TWVRTGRHGRTGHDSSLLLAAGTAGFGNRHGKVWATHLAWSGNHEQFADNVADGRTMVGG
SELLGPAEVVLQPGESYTTPALFAAYSDRGLDGISEAFYSWFRSRPHHVGASSGKARPVV
LNTWEAVYFDHKLDTLIELAESAADLGVERFVLDDGWFRGRRGDHAGLGDWYVDETLWPS
GLTPLIDAVTSRGMEFGLWVEPEMVNLDSDIARAHPEWIVGPSAVSYKDGGRLPLGWRQQ
HVIDLVNPDAWQYIYDRIDALLRENNISYLKWDQNRDLLEHGHAGQASVHEQTLAAYRLF
DALHAAHPGVEIESCSSGGARVDLGILERTDRIWASDCNDALERQTIQRWTGMVVPPELV
GGHIGPTTSHTTGRTHDLSFRAITALFGHFGMEWDVRSVTGEEREELKRFIGLYKEHRGL
IHSGRMVRADVPDESLMVHGVVADAPTSGATAALFAVVKTRTGFSELPGRVTIPGLDPCR
TYRVESIFPAPGDADYGHTFTEAKPAPWVDSGAAASGRFLGEVGLPMPVLNPEHAILLRF
TAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctccatctccgttccgcaggtaccagcctggtgatcagcacccaccgtgga
gaggctgagatagcgcactggggagccgatctgggcgacaccctcccggacttggccatc
ctcaacgagccaatcccgccttcgtccattgacgcgaacgtgcccgcgggcctccttccc
caggcgtcgtcgtcgtggcagggccggccgggacttcgaggccaccgcttcacggacggc
gtgcccggttttgatttctcggtgcgcctgcgcgtcgtgagtgcgacgtcggacggcacc
acagcggtgattgtccaggccgatcccgacgccggcatcacggtcaccagcaacctcacc
ttgcacccgggcggactcctcgaagtgaagcactccgcaaccaaccatggcacgtcgcct
ttccaggtggacgagttggcgaccatgctcccggtggcgccggacgccgtcgaacttctg
gacctgacgggtcgttggtgccgtgagcgccacccccagcgcagggccattcaacaggga
acctgggtccgcacgggccgccatggacggaccggacatgactcctcgctcctgcttgcg
gccggaacagccggcttcggcaacaggcacggcaaggtctgggcgacgcacttggcgtgg
agcggcaaccacgagcagttcgcggacaacgttgccgatggccgcaccatggtgggtggc
tccgagctgttgggacccgccgaagtggtcctgcagcccggcgaaagttacacaactccc
gcactgtttgcggcctactcagaccggggactggacggaatttccgaggctttctactcc
tggttccgttcacggccgcaccacgtgggtgcatcttccggtaaagcccgcccagtagtc
ctcaacacgtgggaagcggtgtatttcgaccacaaactggacaccctgatcgagttggcg
gagtcggctgccgatcttggagttgaacgtttcgtgctcgacgacggctggttccgcggg
cgccgcggcgaccacgcggggctgggcgactggtacgttgacgagaccctctggccgagc
ggcctgactccgttgattgatgccgtgacgtcacgcggcatggagttcgggctgtgggtg
gagccggaaatggtcaatctggactccgacatcgccagggctcatcccgaatggatcgtg
ggcccctcagcggtttcctacaaagacggcggccgcctgcccctcgggtggcggcagcag
catgtgatcgacctcgtgaacccggatgcgtggcagtacatttacgatcggatcgacgcc
ctgctgcgcgagaacaacatcagctacctcaagtgggaccagaaccgcgacctgctggag
cacgggcatgcgggccaggcttcggtgcacgagcaaacccttgccgcgtaccggctgttc
gatgcgctccatgcagcccacccaggggttgagatcgaaagctgctcctccggtggcgcc
cgtgtggaccttgggatcctggagcggacggaccggatctgggcttccgactgcaacgac
gccttggaacggcaaaccatccaacgatggaccggaatggtggtcccgccggaactggtg
ggcggacacattggacccactacgtcgcacaccaccgggcggacgcacgacctctcgttc
cgcgccatcacggcgttgtttggacacttcggcatggagtgggatgtccgttccgtcacc
ggggaggagcgtgaggagctcaagcgcttcatcggactgtacaaggaacaccgtggcctt
attcacagtggccgaatggtgcgggccgatgtgccggacgagtccctgatggtgcacggc
gtggtggctgacgctccaacgtccggtgccacggctgctcttttcgccgtggtgaaaacc
cggacaggctttagcgaactacccggacgggtgaccattccggggttggatccgtgccgg
acctaccgggtggagtcgatcttccctgcccccggggacgccgactacgggcacacgttc
actgaggcaaagccggcgccgtgggtggattccggggctgcggcttcgggacggttcctg
ggtgaggtaggtcttcccatgccggtcctgaacccggagcatgccatcctgctgcggttt
acggccctctga

DBGET integrated database retrieval system