KEGG   Arthrobacter sp. Rue61a: ARUE_c35000Help
Entry
ARUE_c35000       CDS       T02215                                 

Gene name
rafA
Definition
alpha-galactosidase RafA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:arr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:arr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:arr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3850885..3853056
Genome map
AA seq 723 aa AA seqDB search
MHPLHLRSAGTSLVISTHRGEAEIAHWGADLGDTLPDLAILNEPIPPSSIDANVPAGLLP
QASSSWQGRPGLRGHRFTDGVPGFDFSVRLRVVSATSDGTTAVIVQADPDAGITVTSNLT
LHPGGLLEVKHSATNHGTSPFQVDELATMLPVAPDAVELLDLTGRWCRERHPQRRAIQQG
TWVRTGRHGRTGHDSSLLLAAGTAGFGNRHGKVWATHLAWSGNHEQFADNVADGRTMVGG
SELLGPAEVVLQPGESYTTPALFAAYSDRGLDGISEAFYSWFRSRPHHVGASSGKARPVV
LNTWEAVYFDHKLDTLIELAESAADLGVERFVLDDGWFRGRRGDHAGLGDWYVDETLWPS
GLTPLIDAVTSRGMEFGLWVEPEMVNLDSDIARAHPEWIVGPSAVSYKDGGRLPLGWRQQ
HVIDLVNPDAWQYIYDRIDALLRENNISYLKWDQNRDLLEHGHAGQASVHEQTLAAYRLF
DALHAAHPGVEIESCSSGGARVDLGILERTDRIWASDCNDALERQTIQRWTGMVVPPELV
GGHIGPTTSHTTGRTHDLSFRAITALFGHFGMEWDVRSVTGEEREELKRFIGLYKEHRGL
IHSGRMVRADVPDESLMVHGVVADAPTSGATAALFAVVKTRTGFSELPGRVTIPGLDPCR
TYRVESIFPAPGDADYGHTFTEAKPAPWVDSGAAASGRFLGEVGLPMPVLNPEHAILLRF
TAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctccatctccgttccgcaggtaccagcctggtgatcagcacccaccgtgga
gaggctgagatagcgcactggggagccgatctgggcgacaccctcccggacttggccatc
ctcaacgagccaatcccgccttcgtccattgacgcgaacgtgcccgcgggcctccttccc
caggcgtcgtcgtcgtggcagggccggccgggacttcgaggccaccgcttcacggacggc
gtgcccggttttgatttctcggtgcgcctgcgcgtcgtgagtgcgacgtcggacggcacc
acagcggtgattgtccaggccgatcccgacgccggcatcacggtcaccagcaacctcacc
ttgcacccgggcggactcctcgaagtgaagcactccgcaaccaaccatggcacgtcgcct
ttccaggtggacgagttggcgaccatgctcccggtggcgccggacgccgtcgaacttctg
gacctgacgggtcgttggtgccgtgagcgccacccccagcgcagggccattcaacaggga
acctgggtccgcacgggccgccatggacggaccggacatgactcctcgctcctgcttgcg
gccggaacagccggcttcggcaacaggcacggcaaggtctgggcgacgcacttggcgtgg
agcggcaaccacgagcagttcgcggacaacgttgccgatggccgcaccatggtgggtggc
tccgagctgttgggacccgccgaagtggtcctgcagcccggcgaaagttacacaactccc
gcactgtttgcggcctactcagaccggggactggacggaatttccgaggctttctactcc
tggttccgttcacggccgcaccacgtgggtgcatcttccggtaaagcccgcccagtagtc
ctcaacacgtgggaagcggtgtatttcgaccacaaactggacaccctgatcgagttggcg
gagtcggctgccgatcttggagttgaacgtttcgtgctcgacgacggctggttccgcggg
cgccgcggcgaccacgcggggctgggcgactggtacgttgacgagaccctctggccgagc
ggcctgactccgttgattgatgccgtgacgtcacgcggcatggagttcgggctgtgggtg
gagccggaaatggtcaatctggactccgacatcgccagggctcatcccgaatggatcgtg
ggcccctcagcggtttcctacaaagacggcggccgcctgcccctcgggtggcggcagcag
catgtgatcgacctcgtgaacccggatgcgtggcagtacatttacgatcggatcgacgcc
ctgctgcgcgagaacaacatcagctacctcaagtgggaccagaaccgcgacctgctggag
cacgggcatgcgggccaggcttcggtgcacgagcaaacccttgccgcgtaccggctgttc
gatgcgctccatgcagcccacccaggggttgagatcgaaagctgctcctccggtggcgcc
cgtgtggaccttgggatcctggagcggacggaccggatctgggcttccgactgcaacgac
gccttggaacggcaaaccatccaacgatggaccggaatggtggtcccgccggaactggtg
ggcggacacattggacccactacgtcgcacaccaccgggcggacgcacgacctctcgttc
cgcgccatcacggcgttgtttggacacttcggcatggagtgggatgtccgttccgtcacc
ggggaggagcgtgaggagctcaagcgcttcatcggactgtacaaggaacaccgtggcctt
attcacagtggccgaatggtgcgggccgatgtgccggacgagtccctgatggtgcacggc
gtggtggctgacgctccaacgtccggtgccacggctgctcttttcgccgtggtgaaaacc
cggacaggctttagcgaactacccggacgggtgaccattccggggttggatccgtgccgg
acctaccgggtggagtcgatcttccctgcccccggggacgccgactacgggcacacgttc
actgaggcaaagccggcgccgtgggtggattccggggctgcggcttcgggacggttcctg
ggtgaggtaggtcttcccatgccggtcctgaacccggagcatgccatcctgctgcggttt
acggccctctga

DBGET integrated database retrieval system