KEGG   Arthrobacter sp. Rue61a: ARUE_c35390Help
Entry
ARUE_c35390       CDS       T02215                                 

Gene name
uox
Definition
urate oxidase Uox (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:arr00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3901614..3902528
Genome map
AA seq 304 aa AA seqDB search
MTMSNNIVLGENQYGKAEVRVVKVTRDTDRHHIEDLNVTSQLRGDFQAAHLEGDNGHVVA
TDTQKNTVYAFAREGIGSPESFLLRLADHFTGGFDWVTGGRWEAEAYSWDRIQAHGEGHD
HSFVRNGQEVRTAVVVRDGATTHLISGLKDLTVLKTTQSGFVGYPRDKYTTLPETTDRIL
ATDVSARWRYNTNLDFAGTDFNKSYEDIKALLLEGFTENYSHALQQTLFDMGKKVLEAHS
EVDEIKFSMPNKHHFLVDLSPFGLDNPNEVFFAADRPYGLIEATVQRENIEAAPVAWSGI
AGFC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagcaacaacatcgtcctcggcgaaaaccagtacggcaaagcagaagtccgc
gtcgtcaaggtcacccgggatactgaccgccaccacatcgaagacttgaacgtcacctcg
cagctgcgcggcgacttccaggcggcccacctcgaaggcgacaacggacacgtcgttgcc
accgacactcagaagaacacggtctacgcctttgcccgtgaaggcatcggctcacccgag
tccttcctgcttcgcctcgcagaccacttcactggcggattcgactgggtcaccggcggc
cgctgggaagccgaagcctacagctgggatcgcatccaggcccacggcgagggacacgac
cacagcttcgtccgcaacggacaagaggtgcgtaccgccgtcgtcgtccgtgatggcgca
accacacacctcatcagcggcctcaaggacctgaccgtcctgaagaccacgcagtccggt
tttgtcggctacccgcgcgacaagtacacaaccctgccggagaccaccgaccgcatcctg
gccaccgacgtatccgcccgctggcgctacaacaccaacctggacttcgccggcacggac
ttcaacaagagctacgaggacatcaaggcactcctgcttgaaggcttcaccgagaactac
tcccacgcactgcagcagacgctgttcgacatgggcaagaaggtcctggaagctcacagc
gaagtggacgagatcaagttctccatgcccaacaagcaccacttcctggttgacctgagc
ccgttcggcctggacaaccccaacgaggtcttcttcgccgcggatcgcccgtacggcctc
atcgaagcaaccgtccagcgcgagaacatcgaggctgcaccggtggcatggagcggcatc
gccggcttctgctaa

DBGET integrated database retrieval system