KEGG   Arthrobacter sp. Rue61a: ARUE_c37840Help
Entry
ARUE_c37840       CDS       T02215                                 

Gene name
rbsK2
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ARUE_c37840 (rbsK2)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ARUE_c37840 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4149641..4150597
Genome map
AA seq 318 aa AA seqDB search
MTSAPKAGIVVVGSLNADLTIYCDRLPQPGETVHGNGFAVNPGGKSANQAVAASKLGGQV
SLIGAVGDDPNGSMLLDSTASAGVDVSRVRRSDVATGVAVISVDAGGENSIIISAGANGT
LRPSDVTPDAFRDAAVVCLCLEVGIDTVITAAQAGHDAGATVLLNLSPYAEVPERLAGLS
DVLLVNAHEASLFLGAEADVPDADAEAEAWEPVRSQFADRGLQRVLVTLGSRGSVVLDSL
APGTEDQITRIAPTRVSAVDTTGAGDAFTGAVAARLAAGESLADAASFASVAAALAATKK
GTQAAYPGIADVERLRGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcacccaaggcgggaatcgtcgtcgtcggctccctcaacgccgacctgacc
atctattgcgaccgcctcccccaacccggcgagacggtccacggcaacgggttcgccgta
aaccccggcgggaagagcgccaaccaggcggtggctgccagtaagctcggcggtcaggtc
agcctgatcggtgccgtgggtgacgaccccaacggcagcatgctcctggattcgacagcc
agcgccggagtggacgtttcgcgcgtccgacgctccgacgtcgccacaggcgtcgcagtc
atttccgtggacgccggcggcgagaacagcatcatcatctcggccggtgccaatggcacc
ctcaggccttcggatgttacgccggacgccttccgggatgcggctgtagtgtgcctctgc
ctggaggtggggatcgatactgtgattaccgccgcccaagcagggcacgacgccggtgcg
acagttctgctcaacctctcgccttacgccgaggtgccggagcgcttggccgggttgagc
gatgtgctgctggtgaacgcgcacgaggcctcattattccttggtgcagaggccgacgtt
ccggacgccgacgcagaggctgaagcatgggagccggtccggagccagttcgcggaccgt
ggtctgcagcgggttctggtgaccctcggctcacggggttccgtagtactggattcgctg
gcccctggtaccgaggatcagatcacccggatcgccccaacacgcgtttctgcggtggac
accacgggtgccggtgatgccttcactggtgctgtcgctgcgcgcctggccgctggcgaa
tcccttgcggatgccgcgtccttcgcctcggtggctgcggccttggctgccaccaagaag
ggcacgcaggctgcgtacccgggcatcgccgacgtcgagcggctgcggggcgcttag

DBGET integrated database retrieval system