KEGG   Arthrobacter sp. Rue61a: ARUE_c41490Help
Entry
ARUE_c41490       CDS       T02215                                 

Gene name
gbh2
Definition
guanidinobutyrase Gbh (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:arr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4542844..4543917
Genome map
AA seq 357 aa AA seqDB search
MELLTSRSTASTPHPKDSSMATHQPIGPVDATKVPRYAGLGTFARLPQIDRVPDYDIAIV
GVPFDGGTSFRPGARFGPAAVREASRLLRPGYHPELDVEPVYEAQVVDAGDIACTPYDIT
RAVREIEEQALPLISGGNGLSEDKRLISIGGDHTIALPMLRALNKVHGPVALLHFDAHLD
TWDTYFDQPITHGTIFRRAFEEGLLVEDKSMHVGIRGPVYDRNDFLRDHEFGFQIIRCSD
LDVIGVPAAIQRVKDRLGDTPVYVSIDIDVLDPAFAPGTGTPEMGGLHSRELLALLRGLN
GINIVGADVVEVAPAYDHADITTVAAATLVFDLLGLMVNRSKATAGRELASASRTAS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaattacttacttcccgctcaacggcgagcacccctcaccccaaggattcttcaatg
gcaacgcatcagcccatcggccctgtcgacgcaaccaaagttccccggtatgcaggactc
ggtaccttcgcccgtctcccccaaattgaccgcgtcccggactacgacatcgcgatcgta
ggagtaccgttcgacggcggaacctccttccggccgggcgcccgtttcggccctgccgca
gtccgcgaggcctcccggctcctccgcccgggctatcacccggagctcgacgttgaaccg
gtatacgaagcccaagtggtggacgccggcgatattgcctgcaccccctacgacatcact
agggcagtccgcgagatcgaggagcaggcgttgcccctgatcagcggaggcaacgggctc
agcgaggacaagcggctcatctcgatcggcggcgaccacaccatcgccctgcccatgctg
cgagcgctgaacaaggttcatggtccggtggcactgctgcatttcgacgcccacctggac
acgtgggacacctacttcgaccagcccatcacgcatggaaccatcttccgtcgggcgttc
gaggaaggcctccttgtggaggacaagtccatgcacgtgggtatccgcggcccggtctat
gaccgcaacgacttcctccgcgaccacgaattcggcttccagatcatccgttgctcggac
ctggacgttattggggtcccggcggccattcagcgggtgaaggaccggctgggcgatacc
ccggtgtacgtttccatcgatatcgacgtcctggatccggcgttcgcacccggcaccggc
accccggagatgggcgggctccactcccgcgaactccttgccctgctccgcggactgaac
ggcatcaacatcgtgggtgccgacgtcgttgaggtcgccccggcgtatgaccacgctgat
atcaccacggtcgccgcggccaccctggtcttcgaccttctcggcctcatggtgaaccgc
agcaaggccaccgctggccgcgaactggcttcggcatcccggaccgcgtcatga

DBGET integrated database retrieval system