KEGG   Arthrobacter sp. Rue61a: ARUE_c42180Help
Entry
ARUE_c42180       CDS       T02215                                 

Gene name
ybbD
Definition
lipoprotein YbbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c42180 (ybbD)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ARUE_c42180 (ybbD)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ARUE_c42180 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4612323..4614368
Genome map
AA seq 681 aa AA seqDB search
MQRQRTSLMTAAATALLMTGAGVITAAGTAVAAPPTTAGTTTTVSASPNIEAMIAGMTLD
EKIGQMTWTHVYGSSADDASMAAKNQERYGVNTPAEVVEKYNFGGVLYFAWSGNTNNPQQ
VAGLSNGLQQTALREDGNGIPLAVTIDQEGGLVARIGPPATVLPGNMALGATADANLAKA
QGEILGSEMRAMGINVDFAPVLDLNSNPDNPVIGIRSMGEDPALVSALGVAQIEGIQAHN
VGAAAKHFPGHGDTSVDSHYGLPTVTYDRATLNEHLKPFKAAIDGGVDMVMTAHIIVEAI
DAEMPGTLSHTVLTGLLRDEMGFKGLVTTDALDMAAMAAEWPQEEIAVKAIQAGSDILLN
SPDVDASFAGVRAAVESGEITETRLDESVRRILEWKVKRGVFEQPMADPAAVDTLVGSAE
NLATAKLISDRAVTLVRNENGVLPLASGSSVLMVGAGSAWPELAGPMLKDQGFTVTEDYE
DGASPSAAYRARAVAAAGNVDAVVFASYNATSNAAQQQMVAELAATGTPVIVVATRNPYD
VNVFPGADAVLNSYGVKEVNFHGAVRAISGAVNPSGKLPVNVPKADASGVLLPLGFGLSY
EITTPAPVTFTDRPGHGQDGYTIPSVPGVAYMIDGKEVAAGSYRKPSGTVTVTAERLPGY
VFTDGSVTEWTHTFTTGLPKS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagacaacgaacatcactcatgacggcggccgccacggcgctgctcatgacgggc
gcgggggtcatcaccgcggcgggcacggcagtcgcagccccacccaccaccgcgggaact
acgacgacggtctccgcctcgcctaacatcgaggcgatgattgccggcatgacgctggac
gaaaagatcggccagatgacgtggactcacgtttacggttcatcggcggacgacgcctcc
atggcagcaaagaatcaagagcggtacggcgtcaatacacccgccgaggtggtggaaaag
tacaactttggcggcgttctctactttgcgtggtccggcaacaccaacaaccctcagcag
gttgcgggcctttccaacggcttgcagcaaacggccttgcgagaggacgggaacggcatt
ccactggcagtcaccatcgaccaggaaggcggtttggttgcccgcattgggccgcccgcc
acagtcctcccgggaaacatggccctcggcgccaccgcggatgcgaatcttgccaaagca
caaggtgaaatccttggctccgaaatgcgcgccatgggtatcaacgttgatttcgcgccg
gtccttgacctgaactccaaccctgacaacccggtcatcggaatccgatccatgggcgag
gacccggccctggtcagtgccctcggtgttgcccagatcgaaggcattcaagcgcacaac
gtaggcgcggccgccaagcacttccccggccacggcgacacctcagtggattcccactac
ggactgcccaccgtcacttacgatcgcgcaacactcaatgagcacctgaaacccttcaaa
gctgccattgacggcggggtggacatggtcatgacggcccacatcattgttgaggccatc
gacgcggaaatgcccggcaccctgtcccacacggtactcaccggtttgcttcgcgatgag
atgggcttcaaggggttggtgacaactgatgccttggatatggccgcaatggccgccgag
tggccccaggaagaaatcgccgtcaaggcgatccaggccggatctgacatcctcctcaac
tccccggacgtggacgcgtcgttcgccggggttcgcgccgccgtcgaatccggcgagatc
accgagacccgcctggatgagtccgtccgacggatccttgaatggaaggtcaagcgtggg
gtcttcgagcagcctatggcagaccccgccgcggtggacaccttggtgggaagcgcagag
aacctggccacggcaaagctgatctccgaccgcgccgtcaccttggtacgcaatgagaac
ggggtcttgccgctcgcttcgggcagctcggtgctcatggtgggtgccggttcagcgtgg
cccgagctcgcgggaccaatgctcaaggatcagggattcacggtcaccgaagactacgag
gatggggcctcgccctccgcggcctaccgcgcacgtgcggtggctgccgccggcaacgtc
gatgccgtggtcttcgcttcctacaacgcgaccagcaatgctgcgcagcaacagatggtc
gcggaactcgccgccaccggcacaccggtgatcgttgtggcaacccgcaatccctacgac
gtcaacgtcttccccggcgccgacgccgtacttaacagttatggagtcaaagaggtcaat
ttccacggtgctgtccgtgccatctcaggtgcggtcaaccccagcggcaagctgccggtc
aacgtgccgaaggccgacgccagcggtgtcctcctgccgttgggcttcgggctgagctac
gaaattacgacgccggcccccgttaccttcacggaccgcccgggtcatgggcaggacggt
tacaccatcccctccgtcccgggtgttgcgtacatgattgacggcaaggaagtcgccgcc
ggaagctacaggaagccttcaggcactgtgaccgtcacagcggaacggctgcccgggtat
gtcttcaccgacggttccgtcaccgagtggacgcacaccttcaccacagggctccccaaa
tcctag

DBGET integrated database retrieval system