KEGG   Arthrobacter sp. Rue61a: ARUE_c42340Help
Entry
ARUE_c42340       CDS       T02215                                 

Gene name
nahA
Definition
beta-hexosaminidase NahA (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:arr00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:arr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4628341..4629963)
Genome map
AA seq 540 aa AA seqDB search
MSAFHQLIPAPWSFSAGTGELELDAGTSVGADPELRGPRRWLTRALGGATGWDLAPAPAR
EAGIRLLLDPSLDAEAYRLEVSDAVVISAGGVAGAFYGAQTLLQLLGPAALRQAPVVAVE
GWSVPRVSVEDKPRFGYRGTMLDVARHFMPKDNVLRFIEVMAMHKLNVLHLHLTDDQGWR
MQINRYPKLTETGAWRRESSLGSWRAGVFDGRPHGGFYTQDDLREIVAFAADRHITVIPE
IDIPGHSQAAIAAYPELGAGPADGSSPVEVWTRWGINETVLEVSETSLEFYRNVLDEVVE
IFPSPWISLGGDEVPLTQWQASAQAQAKAAELGLDDVSGLHSWFVGQLALHLKHHGRATS
VWDEIGDGGLPDGALVASWRGYEGGIDALRKGYDVVMCPEHKLYLDHRQADGDDEPVPVG
FVTTLQAVYEFEPLPGVEGTDFPGRLLGAQANIWSEHLDSPRRVQFAAFPRLSAISEVFW
SNPAGRDYDEFLTRLTGAHLARLEAMGVEYRPLSGPAPWQQRPGVEGWKRDYDAEHLVRN
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtttcaccaattgatcccagccccgtggtccttctccgcaggcacgggcgag
ttggagctcgacgccggcacttccgtgggtgccgaccctgaactgcgcggtcctcgccgc
tggctcacccgggctttgggcggagctacgggttgggacctggctcccgcgcctgctcgt
gaggcgggcatccgcctcctgctggacccttcgctggacgccgaggcctaccgcttggag
gtgagtgacgccgtcgtgatttctgcgggtggcgttgctggcgctttctacggcgcgcag
acgctattgcagttgttgggaccagcggcgttgaggcaggctcctgttgttgctgttgag
ggatggtcggttccccgtgtgtctgtggaggacaagccgcgattcggctaccgcgggacc
atgctggatgtcgcgcggcatttcatgcccaaggacaacgtgctccggttcatcgaggtg
atggccatgcataaactcaacgttcttcacctgcacctcacggacgatcagggctggcgg
atgcaaattaaccgctaccccaagctgaccgaaactggtgcgtggcgccgggagtcgtcg
cttggttcctggcgcgcaggagtattcgacggccgcccgcacggtggtttctatacgcag
gacgatctccgggagatcgtggcgttcgccgcggaccggcatatcactgtcatcccggag
atcgatattccgggccacagccaagctgccatcgcggcgtatccggagctcggtgcgggc
ccggctgacggttcatctcctgtggaggtatggacgcggtggggcatcaatgagaccgtc
ttggaagtctccgaaacctcgctggagttctaccggaatgtcctggacgaggtggtggag
atcttcccctccccgtggataagcctgggcggcgacgaagtgccactcacgcaatggcag
gcgagtgcccaagcacaggcaaaggctgcagagttgggcttggacgacgtttccggcttg
cacagttggttcgtcgggcagctggcgttgcatctgaagcaccacggccgcgccacgtcc
gtgtgggacgagatcggcgacggcggccttccggacggtgcgcttgtggcgtcctggcgc
gggtacgaaggcgggattgacgccctgcgcaagggctacgacgttgtgatgtgccctgag
cacaagctctacctggaccaccgccaggccgacggtgacgacgaacccgtccccgttggt
ttcgtgaccaccttgcaggctgtctacgagtttgagccgttgccaggagttgaaggcacg
gacttcccgggcaggctcctaggagcccaagccaacatttggagcgagcacttggattca
ccgcgccgcgtgcagttcgcagcgttcccgcgcctcagcgccatctccgaagtgttctgg
tccaaccccgcgggccgggactacgatgagttcctgacccgactcacaggtgcacacttg
gcgcggctcgaggccatgggcgtggagtatcggcctttgtccggtcccgcgccatggcag
cagcggccgggtgtggagggttggaaacgcgattacgacgccgagcacctcgtgaggaac
tga

DBGET integrated database retrieval system