KEGG   Arthrobacter sp. FB24: Arth_0153Help
Entry
Arth_0153         CDS       T00421                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
art  Arthrobacter sp. FB24
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arth_0153
Enzymes [BR:art01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Arth_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
158190..159125
Genome map
AA seq 311 aa AA seqDB search
MDSLAAAPGTGPATSPLPILRKPRPVAKFEDLPSDRTLVMGILNVTPDSFSDGGTHPTPD
TAIAAGLRMFYAGADIIDVGGESTRPGAEEVSPEEEQRRVLPVVEAMVKAGALVSIDTTH
ASTAAAALKAGATIINDVSGLTMEPEMAELAARTGAPYVLTHRRGDAKTMNSLTDYGNVA
EEVAAELVGVRDKLYAAGVAPEQIIVDPGLGFSKNDAQNWELLRNMAPLEALGHRLLVGA
SRKRFLGTLLTVAGKAAAPGERDHATAAITAISAARGAWAVRVHDVGPSLDAVKVAARMS
AGPLSHSSPTN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggactccctagctgcagcccctggaaccggacccgcaacaagccccttgcccatcctg
cgtaaaccgcggccggtagccaagtttgaagatctcccctcggaccgcacgctggtgatg
ggcatcctgaacgtcaccccggactccttcagcgacggcggcacgcacccgacgccggac
accgccatcgccgccggcctccggatgttctacgcgggcgcagacatcatcgacgtcggc
ggcgagtccacccgccccggcgcggaggaagtcagccccgaagaagaacagcgccgtgtc
ctgccggtggtcgaggccatggtcaaggccggcgccctggtcagcattgataccacccac
gcttctacggctgccgctgccctcaaggccggtgccaccattatcaatgacgtctccggg
ctgacgatggagcccgagatggccgaactggccgcccgtaccggtgctccgtacgtgctg
acgcaccgccgcggcgatgccaagaccatgaactcgctcacggactacggcaacgtggcg
gaggaagtagccgctgaactggtgggcgtgcgggacaaactgtatgcggccggagtggcg
ccggaacagatcatcgtggacccgggcctgggcttctccaagaatgatgcccagaactgg
gagctcctgcggaacatggctccgctggaggcgctgggccacaggcttctggtgggcgcc
tcccgcaaacgcttcctcggtaccttgctgaccgtggcgggcaaggctgccgctcccggc
gaacgggaccacgcgactgccgccattacagccatcagcgccgcccgcggcgcatgggct
gtgcgtgtgcacgacgtcggacccagccttgacgccgtcaaggttgccgcacggatgtcc
gccggaccgctcagccattccagtcccaccaactag

DBGET integrated database retrieval system