KEGG   Arthrobacter sp. FB24: Arth_0155Help
Entry
Arth_0155         CDS       T00421                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
art  Arthrobacter sp. FB24
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:art00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
159491..160045
Genome map
AA seq 184 aa AA seqDB search
MNPPYSNNPYVRAVLALGSNLGERNDTLSSAVADLVDRPEVRLIAVSPVVQTKAVGGPEG
QPDFLNMVITVETSLPPSELLRHCQAVENKHHRVREVRWGPRTLDVDIIAYGDVVSSDPA
LTLPHPRAAERAFVLYPWSLIDPSAELNGVRVGELAARAADFPDLAPFDGFGDFDGLPTA
GAVE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccgccgtattcgaacaacccgtatgtccgggcggtactggccctcggcagcaac
ctaggcgagcggaacgacaccctctccagcgccgtcgcggacctcgtggaccgtccggaa
gtgcggctgatcgcggtttccccggtagtccagaccaaggccgtcggcggacctgagggc
cagcctgacttccttaacatggtgatcaccgtggaaacctcgctgccgccctcggagctg
ctgcgccattgccaggccgtggaaaacaagcaccaccgggtgcgcgaagtcaggtggggt
ccgcggaccctggacgtggacatcatcgcttacggtgacgtcgtgagttcggatccggca
ctgaccctcccgcatccccgcgccgcggagcgggcgtttgtgctctacccgtggtcgctc
atcgacccctcggcagagcttaacggcgtccgggtgggcgaacttgccgccagggccgcg
gacttcccggaccttgcccccttcgacggtttcggcgacttcgacggcctgcccacggca
ggggcagtggagtag

DBGET integrated database retrieval system