KEGG   Arthrobacter sp. FB24: Arth_0237Help
Entry
Arth_0237         CDS       T00421                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_0237
   01230 Biosynthesis of amino acids
    Arth_0237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0237
   00030 Pentose phosphate pathway
    Arth_0237
   00051 Fructose and mannose metabolism
    Arth_0237
   00052 Galactose metabolism
    Arth_0237
  Energy metabolism
   00680 Methane metabolism
    Arth_0237
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Arth_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(250598..251560)
Genome map
AA seq 320 aa AA seqDB search
MDASQQLGSKPILTLTVNPALDISTSTEQVSSGHKLRCGASRLDPGGGGINVARVIQRLG
GQTLAVYTAGGPTGEAYRRLIEAERIPTLVVPIQGSTRQDFTVDETSTGKQFRFVLQGPE
LKEPEWQACLDLVAASMPMGGYVVASGSLPPGVPDDFYARVARLARQAGAHCVVDASGPA
LTEALAAGVFLVKPSLRELGTHFGAALDTEPSQVDAASALVADGAAEHVALTLGESGALL
ASKSGLIRLTVPKVPVVSTVGAGDSFLGAFVLRLAQGQPLDAAFRAAVAAGSATVMTPAT
ELCHRADVERLEAELANTAP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctcgcagcagttgggcagtaagccgattctcaccctgacggtgaacccggca
ttggacatcagcacctcaaccgagcaggtcagcagcggccataagctcaggtgcggcgcg
agccgcctcgacccgggcggcggcggcatcaacgtggcgagggtaatccagcgcctgggc
ggacaaaccctggcggtgtacaccgcaggcggacccacgggggaagcctaccgccggctg
atcgaagcggagcgcatcccgacgctggtggtccccatccaagggagcacccgccaggac
ttcaccgtggatgagacgtccaccgggaaacagtttcggttcgtgcttcaaggcccggag
ctcaaagaaccggagtggcaggcctgcctggaccttgtggccgcttccatgccgatgggc
ggctacgtggtggccagcggcagccttccgccgggagtcccggacgacttctatgcgcgg
gttgcccgcctggcacgtcaggccggtgcccactgcgtcgtcgacgcctccgggccggca
ctcaccgaggcgctggctgcgggagtgttcctggttaaaccgagcctccgcgagctgggg
acccatttcggtgccgccctcgacactgagccgagccaggtggacgccgcatccgccctg
gtggctgacggggcggcggaacacgtcgccctgacactcggcgagtccggtgccctgctc
gcgtcgaagtccggcctcatccggctaacggtgccgaaggtgccggtggtcagcacggtg
ggggccggcgacagtttcctgggtgcttttgtgctccggctcgcgcaggggcaaccgctg
gacgcggcgttccgggccgccgtggccgccggcagtgccaccgtcatgacccctgccacc
gaactttgccaccgggccgacgtggaacgactggaggctgagctcgccaacacagcaccg
tga

DBGET integrated database retrieval system