KEGG   Arthrobacter sp. FB24: Arth_0237Help
Entry
Arth_0237         CDS       T00421                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00030  Pentose phosphate pathway
art00051  Fructose and mannose metabolism
art00052  Galactose metabolism
art00680  Methane metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
art01230  Biosynthesis of amino acids
Module
art_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
art_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0237
   00030 Pentose phosphate pathway
    Arth_0237
   00051 Fructose and mannose metabolism
    Arth_0237
   00052 Galactose metabolism
    Arth_0237
  Energy metabolism
   00680 Methane metabolism
    Arth_0237
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Arth_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABK01638
JGI: Arth0237
UniProt: A0JRG8
Position
complement(250598..251560)
Genome map
AA seq 320 aa AA seqDB search
MDASQQLGSKPILTLTVNPALDISTSTEQVSSGHKLRCGASRLDPGGGGINVARVIQRLG
GQTLAVYTAGGPTGEAYRRLIEAERIPTLVVPIQGSTRQDFTVDETSTGKQFRFVLQGPE
LKEPEWQACLDLVAASMPMGGYVVASGSLPPGVPDDFYARVARLARQAGAHCVVDASGPA
LTEALAAGVFLVKPSLRELGTHFGAALDTEPSQVDAASALVADGAAEHVALTLGESGALL
ASKSGLIRLTVPKVPVVSTVGAGDSFLGAFVLRLAQGQPLDAAFRAAVAAGSATVMTPAT
ELCHRADVERLEAELANTAP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctcgcagcagttgggcagtaagccgattctcaccctgacggtgaacccggca
ttggacatcagcacctcaaccgagcaggtcagcagcggccataagctcaggtgcggcgcg
agccgcctcgacccgggcggcggcggcatcaacgtggcgagggtaatccagcgcctgggc
ggacaaaccctggcggtgtacaccgcaggcggacccacgggggaagcctaccgccggctg
atcgaagcggagcgcatcccgacgctggtggtccccatccaagggagcacccgccaggac
ttcaccgtggatgagacgtccaccgggaaacagtttcggttcgtgcttcaaggcccggag
ctcaaagaaccggagtggcaggcctgcctggaccttgtggccgcttccatgccgatgggc
ggctacgtggtggccagcggcagccttccgccgggagtcccggacgacttctatgcgcgg
gttgcccgcctggcacgtcaggccggtgcccactgcgtcgtcgacgcctccgggccggca
ctcaccgaggcgctggctgcgggagtgttcctggttaaaccgagcctccgcgagctgggg
acccatttcggtgccgccctcgacactgagccgagccaggtggacgccgcatccgccctg
gtggctgacggggcggcggaacacgtcgccctgacactcggcgagtccggtgccctgctc
gcgtcgaagtccggcctcatccggctaacggtgccgaaggtgccggtggtcagcacggtg
ggggccggcgacagtttcctgggtgcttttgtgctccggctcgcgcaggggcaaccgctg
gacgcggcgttccgggccgccgtggccgccggcagtgccaccgtcatgacccctgccacc
gaactttgccaccgggccgacgtggaacgactggaggctgagctcgccaacacagcaccg
tga

DBGET integrated database retrieval system