KEGG   Arthrobacter sp. FB24: Arth_0299Help
Entry
Arth_0299         CDS       T00421                                 

Definition
PTS system fructose subfamily transporter subunit IIC
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
art  Arthrobacter sp. FB24
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:art00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:art02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(313094..315166)
Genome map
AA seq 690 aa AA seqDB search
MTQLITTDLVELDQNLGNSPEDVIRHLAGRVAATGRATEAEGLFTDAFARESKTATGVPG
GIAIPHCRSTAVTVPTLAMARLSQPVDFGAKDGPADLIFFIAAPEGADQEHLKLLSKLAR
SLIKKDFTAALRAATTQADIVELVEGALADKPAAAAEPATASAAAGASAAAAPSAGAATG
SRSGGPKRLVAVTACPTGIAHTYMAADSLVAAAKEVGVDLQVETQGSSGAKPLDPAVIAA
ADAVIFAVDVDVRGKERFAGMPVINAPVKRGIDEPDKMVQEALAAADNPNARRVPHYGAE
EQAEAEATEKGEHIGQKLKKALLTGVSYMIPFVAGGGLLIALGFLMGGYLITQFADAIVV
DNSIFNLPTEYPENAWGPLGAYLGAVLFKIGALSLGFLVPALAGYIAYGIADRPGIAPGF
VAGAVAGFMGAGFLGGIVGGLLAGYIAHSIGKIQVARWLRGLMPVVIIPLVASLVASGLM
FLILGAPIVAITKGLNGWLSGLTGASAIALGVILGLMMCFDLGGPVNKVAYSFAVAGLGA
ATLDNQAPWQIMAAVMASGMVPPLAMALASTVLDKKRFSLAERENGKAAWLLGASFISEG
AIPFAAADPLRVIPASMLGGAVTGAISMAAGVGSKAPHGGIFVFFAIDNFVMFVVSILVG
TVVTALAVIALKRWAVRKSVDTVEPVPVTV
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
gtgactcagctcattactactgatctggtcgagctagaccagaacctgggcaactcgccc
gaggacgtgatccgccatctggccggcagggttgccgccacaggacgcgccaccgaggcg
gaaggcctcttcacggacgcctttgcccgggagtccaaaaccgccaccggcgttcctggc
ggaattgccattccgcactgccgctccactgcggtgacggtgcccaccctggccatggcc
cggctctcgcagcctgtggacttcggcgccaaggacggcccggcggacctcatcttcttc
atcgcagcccctgagggtgcggaccaggagcatttgaagctcctgtccaagctggcccgc
tcgctgatcaagaaggacttcaccgcggcgctccgcgcagccaccacgcaggccgacatt
gttgaactggtggaaggagccctggccgacaagcccgcggccgccgcagaacccgcaaca
gcaagcgcggcagccggggcaagcgcagccgcagcaccgtccgccggtgccgccaccggt
tcccggtccgggggtcccaagcgcctcgtggccgtgacggcctgccccacgggcatcgcc
cacacctacatggccgccgactccctcgtcgcagcagccaaggaagtcggtgtggacctg
caggtggaaacccagggttcctccggagccaagccgctggaccccgccgtcatcgcggcc
gccgacgccgtgattttcgcggtggacgtggacgtccgcggcaaggagcgcttcgccggc
atgccggtcatcaacgctccggtcaagcgcggcattgacgagccggacaaaatggtccag
gaggcactggccgccgcggacaaccccaacgcccgccgggtcccgcactacggcgccgag
gagcaggctgaagccgaggccaccgaaaagggcgagcacatcggccagaagctgaagaag
gcgctcctcaccggtgtcagctacatgatcccgtttgtggccggcggcggtctcctgatc
gccctgggcttcctgatgggcggctacctgattacccagttcgcggacgccatcgtggtg
gacaacagcatcttcaacctgcccaccgaataccctgagaacgcctggggcccgctcggc
gcctacctcggtgccgtgctcttcaagatcggcgccctgtccctcggcttcctggtcccc
gcattggccggctacatcgcctacggcatcgccgaccgcccgggcatcgcaccgggcttc
gtggcaggcgccgtcgcagggttcatgggtgcaggcttcctcggcggcatcgtgggcggc
ctgctggccggctacatcgcccattccatcggcaagatccaggtggcccgctggctgcgc
ggcctgatgcccgtggtgatcattccgctggtggcctccctcgtggcttccggcctgatg
ttcctgatcctgggcgccccgatcgtagccatcaccaagggcctgaacggttggctctcc
ggactcaccggtgccagcgccatcgcgctgggcgtcatcctgggcctcatgatgtgcttc
gacctcggcggcccggtcaacaaggttgcctactcgttcgccgtcgccggcctgggtgcc
gcaaccctggacaaccaggcaccgtggcagatcatggcagccgtcatggcctcgggcatg
gttccgccgctggccatggccctcgcttccaccgtcctggacaagaagcgtttcagcctg
gccgagcgtgaaaacggcaaggccgcctggctgctgggagcgtccttcatctccgaaggc
gccatcccgttcgccgcggccgatccgctccgcgtcatccccgccagcatgctcggcggc
gcagtcaccggtgccatctccatggcagcgggcgtaggctcgaaggccccgcacggaggc
atcttcgtcttcttcgcaatcgacaacttcgtgatgttcgtcgtctcgatccttgtcggc
accgtcgtcaccgccctggcagtgatcgccctcaagcgctgggccgtccgcaagtccgtt
gataccgtggagccggttccagtaactgtctga

DBGET integrated database retrieval system