KEGG   Arthrobacter sp. FB24: Arth_0421Help
Entry
Arth_0421         CDS       T00421                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
art  Arthrobacter sp. FB24
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Arth_0421
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arth_0421
   00650 Butanoate metabolism
    Arth_0421
  Lipid metabolism
   00071 Fatty acid degradation
    Arth_0421
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arth_0421
   00310 Lysine degradation
    Arth_0421
   00360 Phenylalanine metabolism
    Arth_0421
   00380 Tryptophan metabolism
    Arth_0421
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arth_0421
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arth_0421
   00281 Geraniol degradation
    Arth_0421
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arth_0421
   00627 Aminobenzoate degradation
    Arth_0421
   00930 Caprolactam degradation
    Arth_0421
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arth_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
450470..451582
Genome map
AA seq 370 aa AA seqDB search
MSAGPTAGTNTDRPDETPTEDMLFERRGRLGVITLNRPRAVNALTAGMAAAMLGQLTAWA
DDDGVATVLVHGAGDRGLCAGGDIVAIYEDMLAGGEATADFWRTEYRLNALIAGYPKPYV
AFMDGLVLGGGVGISAHGSVRIVTERTRTGMPETTIGFVPDVGGTLLLSRSPGETGTHAA
LTGAHLSGADALFLGLADHFVASGNLPALAAALETEPAEDAVERFAEKPPVSVLAGQQDW
IDACYASDDAEDILRRLRTFDGDAAGEASEAAATIEAKSPTAVKVALKSLRRARTLTLEE
ALAQEYRVGLRFLAGADFREGIRAQVVDKDRNPQWKPASLHEVSTADVERFFEPLGDREL
NLQSKEARNV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggacctaccgcaggtacgaacacagaccgccccgatgagacgcccactgag
gacatgctgtttgagcggcgcgggcgcctcggcgtcatcacgctgaaccggccccgggca
gtgaacgcgctcaccgccggcatggccgcggccatgctggggcagctcaccgcatgggcg
gacgacgacggcgtggccaccgttctggtgcacggtgccggagaccggggattgtgcgcc
gggggcgacatcgtggcgatctacgaggacatgcttgcgggcggagaagccaccgcggac
ttctggcgcaccgaataccggctgaatgcgctgatcgccggctatcccaaaccatatgtg
gccttcatggacggcctggtgctcggcggcggcgtggggatttcggcgcacggttccgtg
cgcatagtcaccgagcgcacccgcaccggcatgccggagaccaccatcggattcgtgccg
gacgtcggcggcaccctgctgctgtcccggtcgccgggcgagacgggcacccatgcggcc
ctgaccggcgcccatctgagcggcgcggacgccctcttcctgggcctggcggaccacttc
gtggcgtccgggaacctccctgcgctggcagctgcgctggaaactgaaccggcggaagac
gccgtcgaacgcttcgcggaaaagccgcccgtgtcggtgctggccggacagcaggactgg
atcgacgcctgttacgcaagcgacgacgcggaggacatcctccgccggctgcgcactttc
gacggcgacgctgccggtgaggcgtcggaggcggccgccactatcgaggcaaagtcgccc
acggccgtgaaggtggcactgaaatcgctccgccgtgcacgaacgctgacgctggaggag
gccctcgcccaggaataccgcgttggtctgcggttcctggcaggtgcggatttccgcgaa
ggtatccgtgcacaggtggtggacaaggaccggaacccgcagtggaagccggccagcctg
catgaggtttccaccgccgacgtcgagaggttcttcgagccgctgggggaccgggaactc
aacctgcaatccaaggaggcccgcaatgtctga

DBGET integrated database retrieval system