KEGG   Arthrobacter sp. FB24: Arth_0508Help
Entry
Arth_0508         CDS       T00421                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:art01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:art00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:art00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:art00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(541157..542590)
Genome map
AA seq 477 aa AA seqDB search
MPSLGADMEHGKMVEWLIKPGDYVHRGDVVAVVDTDKTVMDVESFEEGVVAELLVDVGTT
VPIGTPLARITRTPDDGAGQAGGRPAGPHAKPASGAAETAVAAAAAEPAGAAAAAAAVQV
PPPVRHLAHQLGVDTAGIRGTGRHGAVTRADVEHAAAARPGPAAPAAPAATPAPMPHGAR
VRSSPRARRLADQLGVDIGGVPGTGPDGAVTEADVQRAVSGHTAAAPAEEALPEEATVPG
AEALPPKEAPPSEAQDRLSSLRRAIGSLMTRSKKSIPHYYVSTTLDLRAAIAWMQQVNEQ
RPVASRLVPSALLLKATALAAKEVPEVNGFFTDGVFRPSSSVHLGVAVALRHGGLVAPAI
HDADTLAVDVLMQQLRDLVSRARAGRLQRAEMADPTLTVTNLGDLGVEAVYGVIYPPQVA
MVGLGKLVEQPWAHDGMLGVRPAVTATLSADHRVSDGLRGGRFLARIDELLQKPEEL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccttggtgcggacatggagcacggcaagatggtggagtggctcatcaagccg
ggcgactacgtgcaccgcggcgatgtggtggccgttgtggacacggacaagacggtgatg
gacgtggagtccttcgaagagggcgtggtggcagaactgctggtggatgtgggcaccacc
gttcccatcggcactccgctggcccggatcacccggacacccgacgacggcgctggccag
gcaggagggcggcctgcgggtccgcacgcgaagccggcttcaggagcggcagagacagca
gtcgcggcagctgccgcggagccggcaggcgctgccgctgccgctgccgcggtgcaagtt
cctcccccggtccggcacctcgcgcaccagcttggggtggatacggcagggatacgcgga
acgggaaggcacggcgccgtcacccgcgccgatgtggagcacgccgcagcggcccggccc
ggtccggcggccccggcagctccggcagccacccctgcgccgatgccccacggagcccgg
gtgcggtcctcgccgcgggcccggcggctcgcggaccagcttggcgtcgacatcgggggt
gtgccaggcacggggcccgacggcgccgtcaccgaagctgatgtccagcgtgccgtaagc
gggcacactgcggcggctccggcagaagaggccctaccggaagaagccaccgttcccggg
gcggaggcgctgcccccgaaggaggcgccgccgtcggaagcgcaggaccgcttgtccagc
ctgcggcgcgccatcggctcgctcatgacccggtccaagaagtccatcccgcactactac
gtcagcaccacgctggacctgcgcgccgccatcgcgtggatgcagcaggtcaacgaacag
cggccggtggcctcgcggcttgttccctcggcgctgctgttgaaggcaacggccctggct
gccaaggaggttccggaagtcaacggcttcttcaccgacggggtgttccggccgagcagc
tccgtgcacctcggcgttgcggtggccctgcggcacggcggactggtggcgcccgccatc
cacgacgccgacaccctggccgtggatgtgctgatgcagcagctgcgggacttggtcagc
cgggctcgggccgggcggctgcagcgcgcggaaatggccgatcccaccctcacggtgacg
aatctgggcgacctcggcgtggaggccgtttacggcgtcatctatccgccgcaggtggcc
atggtgggcctgggcaagctggtggagcagccctgggcgcacgacgggatgctcggtgtg
cggcccgctgtgaccgccaccctgtccgccgaccaccgggtcagcgacgggctccggggc
ggccgcttcctggcccgcatcgacgaactgctgcaaaaaccggaggagctatga

DBGET integrated database retrieval system