KEGG   Arthrobacter sp. FB24: Arth_0508Help
Entry
Arth_0508         CDS       T00421                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_0508
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0508
   00020 Citrate cycle (TCA cycle)
    Arth_0508
   00620 Pyruvate metabolism
    Arth_0508
Enzymes [BR:art01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Arth_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(541157..542590)
Genome map
AA seq 477 aa AA seqDB search
MPSLGADMEHGKMVEWLIKPGDYVHRGDVVAVVDTDKTVMDVESFEEGVVAELLVDVGTT
VPIGTPLARITRTPDDGAGQAGGRPAGPHAKPASGAAETAVAAAAAEPAGAAAAAAAVQV
PPPVRHLAHQLGVDTAGIRGTGRHGAVTRADVEHAAAARPGPAAPAAPAATPAPMPHGAR
VRSSPRARRLADQLGVDIGGVPGTGPDGAVTEADVQRAVSGHTAAAPAEEALPEEATVPG
AEALPPKEAPPSEAQDRLSSLRRAIGSLMTRSKKSIPHYYVSTTLDLRAAIAWMQQVNEQ
RPVASRLVPSALLLKATALAAKEVPEVNGFFTDGVFRPSSSVHLGVAVALRHGGLVAPAI
HDADTLAVDVLMQQLRDLVSRARAGRLQRAEMADPTLTVTNLGDLGVEAVYGVIYPPQVA
MVGLGKLVEQPWAHDGMLGVRPAVTATLSADHRVSDGLRGGRFLARIDELLQKPEEL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccttggtgcggacatggagcacggcaagatggtggagtggctcatcaagccg
ggcgactacgtgcaccgcggcgatgtggtggccgttgtggacacggacaagacggtgatg
gacgtggagtccttcgaagagggcgtggtggcagaactgctggtggatgtgggcaccacc
gttcccatcggcactccgctggcccggatcacccggacacccgacgacggcgctggccag
gcaggagggcggcctgcgggtccgcacgcgaagccggcttcaggagcggcagagacagca
gtcgcggcagctgccgcggagccggcaggcgctgccgctgccgctgccgcggtgcaagtt
cctcccccggtccggcacctcgcgcaccagcttggggtggatacggcagggatacgcgga
acgggaaggcacggcgccgtcacccgcgccgatgtggagcacgccgcagcggcccggccc
ggtccggcggccccggcagctccggcagccacccctgcgccgatgccccacggagcccgg
gtgcggtcctcgccgcgggcccggcggctcgcggaccagcttggcgtcgacatcgggggt
gtgccaggcacggggcccgacggcgccgtcaccgaagctgatgtccagcgtgccgtaagc
gggcacactgcggcggctccggcagaagaggccctaccggaagaagccaccgttcccggg
gcggaggcgctgcccccgaaggaggcgccgccgtcggaagcgcaggaccgcttgtccagc
ctgcggcgcgccatcggctcgctcatgacccggtccaagaagtccatcccgcactactac
gtcagcaccacgctggacctgcgcgccgccatcgcgtggatgcagcaggtcaacgaacag
cggccggtggcctcgcggcttgttccctcggcgctgctgttgaaggcaacggccctggct
gccaaggaggttccggaagtcaacggcttcttcaccgacggggtgttccggccgagcagc
tccgtgcacctcggcgttgcggtggccctgcggcacggcggactggtggcgcccgccatc
cacgacgccgacaccctggccgtggatgtgctgatgcagcagctgcgggacttggtcagc
cgggctcgggccgggcggctgcagcgcgcggaaatggccgatcccaccctcacggtgacg
aatctgggcgacctcggcgtggaggccgtttacggcgtcatctatccgccgcaggtggcc
atggtgggcctgggcaagctggtggagcagccctgggcgcacgacgggatgctcggtgtg
cggcccgctgtgaccgccaccctgtccgccgaccaccgggtcagcgacgggctccggggc
ggccgcttcctggcccgcatcgacgaactgctgcaaaaaccggaggagctatga

DBGET integrated database retrieval system