KEGG   Arthrobacter sp. FB24: Arth_0511Help
Entry
Arth_0511         CDS       T00421                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:art01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:art00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:art00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:art00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:art00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(544573..546396)
Genome map
AA seq 607 aa AA seqDB search
MTAGTAPSTRWPAIPKDISGLAVRPNMVDYDASRAAFSWDEARHALAGLPDGGVNIAYEA
VDRHAAGERAGHEALRFIRSDGTARSLSYAELAEQTGRFAGVLHRLGIGRGERVFSLMGR
SPELYVAVLGTLKNASVFCPLFSAFGPEPVRQRLHLGSGRALVTTRALYRRKVAQIRDEL
PELEFVLLIDAEGRPDPGTLDLAELMRDAQPRETVPTRAEEMALLHFTSGTTGTPKGAIH
VHDAVTAHHATGFFALDLHADDVYWCTADPGWVTGTSYGVIAPLTHGVTTIVDEEEMDAE
RWYRILAEQHVTVWYTAPTALRMLMKAGAGHAAGHDLSALRFVASVGEPLNPEVVVWGQE
AFGQPVHDNWWQTETGGIMISNYPAMEIRPGSMGRPLPGVEAAIVARDPDGKAVILNGEA
VLVTEPEGVGELALRPGWPSMFRGYLHEDERYLRCFAGGWYLTGDLARMDADGYFWFVGR
GDDVIKSSGHLIGPFEVESSLMEHEAVAEAGVIGVPDPVAGEVVKAFVELRTGWQPSESL
KLDIIGFARKRLGPAVAPRLLDFTDALPKTRSGKILRRLLKARELGLPEGDTSTIESPPG
RYPGAPV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgacggccggaaccgctccatcgacccgctggcccgcaatccccaaggacatcagcggc
ctcgccgtccgcccgaatatggtggactacgatgccagccgcgccgcattctcctgggat
gaggcgcggcacgcgctggccggactgcccgacggcggcgtcaacattgcgtacgaggcg
gtggaccgccacgccgcgggagaacgggcaggccacgaagcgctgcgtttcatccgctcc
gacggtaccgcccggtccctgagctacgcagagctggcggaacagactggacggtttgcc
ggcgtcctgcaccggctgggtatcggccgcggcgaacgggtcttttcgcttatgggccgc
agcccggagctgtatgtcgccgtgttgggaacgctcaagaatgccagcgtgttctgcccc
ctgttttccgccttcggcccggagcccgtccgtcagcggctccatctgggatccggccgc
gccctggtcaccacacgggcgctgtaccggcggaaggttgcccagatacgtgacgaactg
ccggagctggaattcgtgctgctcattgacgccgagggccggccggaccccggaaccctg
gatctggccgaactgatgcgggacgcgcagccgcgcgaaaccgtcccgacccgcgccgaa
gaaatggccctgctgcacttcaccagcggcaccaccggcacccccaaaggcgccattcat
gtgcacgacgccgtcacggcgcaccacgccactggcttcttcgcgctggacctgcacgcg
gacgacgtctactggtgcacggccgatcccggctgggtcaccggcacctcctacggcgtg
atcgctcccctcacccacggcgtgaccaccattgtggacgaagaggagatggacgcggaa
aggtggtaccggatcctcgcggagcagcacgtcaccgtctggtacaccgcacccaccgca
ctgcgcatgctgatgaaggccggtgccgggcacgcagcagggcacgatctgtccgccctg
cgttttgtggccagcgtgggcgagccgctcaaccccgaagtggtggtgtggggccaggaa
gccttcggccagcctgtccatgacaactggtggcagaccgaaaccggcggcatcatgatt
tcgaactaccccgccatggagatccggcccggttccatggggcggccccttcccggcgtt
gaggccgcgattgtggcccgggacccggacggcaaagcggtgatcctgaacggcgaggcc
gtcctcgtgaccgaaccggagggggttggcgaactggccctccgtccgggctggccttcg
atgttccgcggctacctccacgaagacgagcggtacctgcgatgctttgccggcggctgg
tacctcaccggagacctcgccaggatggacgccgacgggtacttctggttcgtcggccgg
ggcgacgacgtcatcaagtcctcgggccacctgatcggcccgttcgaggtggagagctcg
ctgatggagcacgaagcggtggccgaggcaggggtgatcggcgtgccggatcccgttgcc
ggcgaagtggtcaaggccttcgtggaactccgcaccgggtggcagccctcggagtcactc
aagctggacatcatcggcttcgcccgcaaacggctgggtcccgcggtggctccccggctg
ctggacttcaccgacgccctgccgaagacccggagcggcaagatcctccggcggctcctg
aaggcccgcgaactcggcctcccggagggtgacacctcaaccatcgagtcacctcccggt
cgctaccccggagcgcccgtatga

DBGET integrated database retrieval system