KEGG   Arthrobacter sp. FB24: Arth_0511Help
Entry
Arth_0511         CDS       T00421                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_0511
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0511
   00620 Pyruvate metabolism
    Arth_0511
   00640 Propanoate metabolism
    Arth_0511
  Energy metabolism
   00680 Methane metabolism
    Arth_0511
Enzymes [BR:art01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Arth_0511
Lipid biosynthesis proteins [BR:art01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Arth_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(544573..546396)
Genome map
AA seq 607 aa AA seqDB search
MTAGTAPSTRWPAIPKDISGLAVRPNMVDYDASRAAFSWDEARHALAGLPDGGVNIAYEA
VDRHAAGERAGHEALRFIRSDGTARSLSYAELAEQTGRFAGVLHRLGIGRGERVFSLMGR
SPELYVAVLGTLKNASVFCPLFSAFGPEPVRQRLHLGSGRALVTTRALYRRKVAQIRDEL
PELEFVLLIDAEGRPDPGTLDLAELMRDAQPRETVPTRAEEMALLHFTSGTTGTPKGAIH
VHDAVTAHHATGFFALDLHADDVYWCTADPGWVTGTSYGVIAPLTHGVTTIVDEEEMDAE
RWYRILAEQHVTVWYTAPTALRMLMKAGAGHAAGHDLSALRFVASVGEPLNPEVVVWGQE
AFGQPVHDNWWQTETGGIMISNYPAMEIRPGSMGRPLPGVEAAIVARDPDGKAVILNGEA
VLVTEPEGVGELALRPGWPSMFRGYLHEDERYLRCFAGGWYLTGDLARMDADGYFWFVGR
GDDVIKSSGHLIGPFEVESSLMEHEAVAEAGVIGVPDPVAGEVVKAFVELRTGWQPSESL
KLDIIGFARKRLGPAVAPRLLDFTDALPKTRSGKILRRLLKARELGLPEGDTSTIESPPG
RYPGAPV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgacggccggaaccgctccatcgacccgctggcccgcaatccccaaggacatcagcggc
ctcgccgtccgcccgaatatggtggactacgatgccagccgcgccgcattctcctgggat
gaggcgcggcacgcgctggccggactgcccgacggcggcgtcaacattgcgtacgaggcg
gtggaccgccacgccgcgggagaacgggcaggccacgaagcgctgcgtttcatccgctcc
gacggtaccgcccggtccctgagctacgcagagctggcggaacagactggacggtttgcc
ggcgtcctgcaccggctgggtatcggccgcggcgaacgggtcttttcgcttatgggccgc
agcccggagctgtatgtcgccgtgttgggaacgctcaagaatgccagcgtgttctgcccc
ctgttttccgccttcggcccggagcccgtccgtcagcggctccatctgggatccggccgc
gccctggtcaccacacgggcgctgtaccggcggaaggttgcccagatacgtgacgaactg
ccggagctggaattcgtgctgctcattgacgccgagggccggccggaccccggaaccctg
gatctggccgaactgatgcgggacgcgcagccgcgcgaaaccgtcccgacccgcgccgaa
gaaatggccctgctgcacttcaccagcggcaccaccggcacccccaaaggcgccattcat
gtgcacgacgccgtcacggcgcaccacgccactggcttcttcgcgctggacctgcacgcg
gacgacgtctactggtgcacggccgatcccggctgggtcaccggcacctcctacggcgtg
atcgctcccctcacccacggcgtgaccaccattgtggacgaagaggagatggacgcggaa
aggtggtaccggatcctcgcggagcagcacgtcaccgtctggtacaccgcacccaccgca
ctgcgcatgctgatgaaggccggtgccgggcacgcagcagggcacgatctgtccgccctg
cgttttgtggccagcgtgggcgagccgctcaaccccgaagtggtggtgtggggccaggaa
gccttcggccagcctgtccatgacaactggtggcagaccgaaaccggcggcatcatgatt
tcgaactaccccgccatggagatccggcccggttccatggggcggccccttcccggcgtt
gaggccgcgattgtggcccgggacccggacggcaaagcggtgatcctgaacggcgaggcc
gtcctcgtgaccgaaccggagggggttggcgaactggccctccgtccgggctggccttcg
atgttccgcggctacctccacgaagacgagcggtacctgcgatgctttgccggcggctgg
tacctcaccggagacctcgccaggatggacgccgacgggtacttctggttcgtcggccgg
ggcgacgacgtcatcaagtcctcgggccacctgatcggcccgttcgaggtggagagctcg
ctgatggagcacgaagcggtggccgaggcaggggtgatcggcgtgccggatcccgttgcc
ggcgaagtggtcaaggccttcgtggaactccgcaccgggtggcagccctcggagtcactc
aagctggacatcatcggcttcgcccgcaaacggctgggtcccgcggtggctccccggctg
ctggacttcaccgacgccctgccgaagacccggagcggcaagatcctccggcggctcctg
aaggcccgcgaactcggcctcccggagggtgacacctcaaccatcgagtcacctcccggt
cgctaccccggagcgcccgtatga

DBGET integrated database retrieval system