KEGG   Arthrobacter sp. FB24: Arth_0559Help
Entry
Arth_0559         CDS       T00421                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
art  Arthrobacter sp. FB24
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Arth_0559
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Arth_0559
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Arth_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
599592..600077
Genome map
AA seq 161 aa AA seqDB search
MNSLHSIPLTLNDGTTTDFGRFKGRVVLVVNVASQCGFTPQYAGLELLYGKFKDQGFEIL
GVPCNQFAGQEPGSDDEIAEFCERNFGVTFPLTAKADVRGKNQHPLYAELTRFKNGLLPG
LVKWNFEKFLVNRDGVVVARFAPTVEPDSPEVIAAIEEALA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcgctccactccattccgctcaccctcaacgacggcacgacaaccgattttggc
cgcttcaagggacgcgtggtgctggtggtcaacgtggcctcccagtgcggcttcaccccg
cagtacgcaggccttgagttgctctacgggaagttcaaggaccagggattcgaaatcctg
ggggtgccctgcaaccagttcgccgggcaggagccgggaagcgacgacgaaatcgccgaa
ttctgcgagcgcaatttcggcgtgacattcccgctgacagcgaaggctgatgttcgcggc
aagaaccagcacccgctgtacgcggagctcacccgcttcaagaacggtctcctcccgggc
ctggtgaagtggaactttgaaaagttcctggtaaaccgcgacggcgttgtggtggcccgc
ttcgcccccactgtggaaccggactcgccggaggtcatcgccgccattgaagaagccctc
gcctga

DBGET integrated database retrieval system