KEGG   Arthrobacter sp. FB24: Arth_0559Help
Entry
Arth_0559         CDS       T00421                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
art  Arthrobacter sp. FB24
Pathway
art00480  Glutathione metabolism
art00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Arth_0559
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Arth_0559
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Arth_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABK01958
JGI: Arth0559
UniProt: A0JSD8
Position
599592..600077
Genome map
AA seq 161 aa AA seqDB search
MNSLHSIPLTLNDGTTTDFGRFKGRVVLVVNVASQCGFTPQYAGLELLYGKFKDQGFEIL
GVPCNQFAGQEPGSDDEIAEFCERNFGVTFPLTAKADVRGKNQHPLYAELTRFKNGLLPG
LVKWNFEKFLVNRDGVVVARFAPTVEPDSPEVIAAIEEALA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcgctccactccattccgctcaccctcaacgacggcacgacaaccgattttggc
cgcttcaagggacgcgtggtgctggtggtcaacgtggcctcccagtgcggcttcaccccg
cagtacgcaggccttgagttgctctacgggaagttcaaggaccagggattcgaaatcctg
ggggtgccctgcaaccagttcgccgggcaggagccgggaagcgacgacgaaatcgccgaa
ttctgcgagcgcaatttcggcgtgacattcccgctgacagcgaaggctgatgttcgcggc
aagaaccagcacccgctgtacgcggagctcacccgcttcaagaacggtctcctcccgggc
ctggtgaagtggaactttgaaaagttcctggtaaaccgcgacggcgttgtggtggcccgc
ttcgcccccactgtggaaccggactcgccggaggtcatcgccgccattgaagaagccctc
gcctga

DBGET integrated database retrieval system