KEGG   Arthrobacter sp. FB24: Arth_0580Help
Entry
Arth_0580         CDS       T00421                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00052  Galactose metabolism
art00500  Starch and sucrose metabolism
art00520  Amino sugar and nucleotide sugar metabolism
art00521  Streptomycin biosynthesis
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
art_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0580
   00052 Galactose metabolism
    Arth_0580
   00500 Starch and sucrose metabolism
    Arth_0580
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_0580
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arth_0580
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Arth_0580
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arth_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK HTH_24 MarR_2 HTH_20 HTH_IclR HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ABK01979
JGI: Arth0580
UniProt: A0JSF9
Position
620121..621353
Genome map
AA seq 410 aa AA seqDB search
MSPTSGKETGIDAGTDAAPDGAGSLSRAGDLFQLLRDGKARTRAELALTTGLARSTVAAR
IDALISSGLVGPAGEASSSGGRPPSRFAFNPAARSVLAVDVGATHVIVAVTDLGGNVLAE
RRLAQDVADGPEAVLGRVVEEGKTLLSEAGRTAADLAGIGIGLPGPVEHATGMPVKPPIM
PGWDGFDVVRYVRRSLPVPVLVDNDVNIMALGERTAYWPEHDNFLFIKVATGIGAGIISS
GELQRGANGTAGDLGHVRVPRGDEVLCRCGNYGCLEALASGPAVARELARHGLPAEKGSD
VLRLVAEGNLQAIQALRQAGRDVGDVLATVVNLLNPSVIVIGGSLGQAGEHLMAGVREVV
YRRSLPLATSHLRIALSMAGDQAAILGASQMVTQHVLSPAVIEATLQATG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtccaacgtccggaaaagagaccggcatcgacgccggaaccgatgccgcgcctgat
ggtgcggggagcctttcccgggccggcgacctcttccagctgctccgcgacggcaaggcc
cgcaccagggccgaactggccctgacgactggcctggcacggtccacggtggccgcccgc
atcgacgcgctcatctcctccggactggtgggcccggccggtgaggccagttccagcggc
ggcaggccgccgtcgcgctttgccttcaaccccgccgcccgctctgtcctggcagtcgac
gtcggcgccacgcacgtgatcgttgccgtcaccgaccttggcggcaacgtccttgccgaa
cggcgcctggcccaggacgttgccgacggtccggaagcggtactgggccgtgtggtcgag
gaaggaaaaacactcctcagtgaggcaggccggacagccgcggacctcgccggcatcggg
atcgggctgcccggcccggtggagcatgccaccggcatgccggttaagccgcccatcatg
cccggctgggacgggttcgacgtggtgcgttacgttcggcgctcgctgccggtccccgtg
ctggtggacaacgacgtcaacatcatggcgctcggcgaacgcacggcgtactggcccgaa
cacgacaacttccttttcatcaaggtggccaccggcatcggtgcaggaatcatcagcagc
ggcgaactccagcgcggcgccaacggaacggccggggacctgggccatgtaagggtcccg
cgcggggacgaagtcctttgccgctgcggcaactacggctgcctcgaggcactggcttcg
ggccccgccgtcgcccgcgaactggcccgccatgggcttccggccgagaagggaagcgat
gtgctgcgactcgttgccgagggaaacctgcaggccatccaggcgctccgccaggccggc
cgggacgtcggggacgtactggctacggtggtcaacctgctgaatccgtcggtgatcgtg
atcggcggcagcctcggccaggcgggcgagcacctgatggcgggagtgcgcgaagtggtt
taccggcggtcgctgccgctggccacgtcacatcttcggatagccctttcgatggccggg
gaccaggccgcgatccttggcgccagccagatggtcacgcaacacgtgttatctcctgcc
gtgatagaagccaccctgcaggcaacgggataa

DBGET integrated database retrieval system