KEGG   Arthrobacter sp. FB24: Arth_0721Help
Entry
Arth_0721         CDS       T00421                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_0721 (gpmA)
   01230 Biosynthesis of amino acids
    Arth_0721 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0721 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Arth_0721 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arth_0721 (gpmA)
Enzymes [BR:art01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Arth_0721 (gpmA)
Exosome [BR:art04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Arth_0721 (gpmA)
  Exosomal proteins of melanoma cells
   Arth_0721 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
767886..768632
Genome map
AA seq 248 aa AA seqDB search
MTYKLILLRHGHSEWNAKNLFTGWVDVDLNDQGREEAARGGELLVENNVLPDVLYTSLLK
RAINTANIALDKADRGWIPVKRDWRLNERHYGALQGKDKAQTLAEYGEEQFMEWRRSYDT
PPPPLDDDSEFSQAHDPRYADLGDALPRTECLKDVLIRLMPYWESDIKEDLKAGKTVLVT
AHGNSLRALVKHLDGISDEAIAGLNIPTGIPLVYDLDENFKPLNPGGTYLDPEAAAESIK
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaagctgattctgctgcgccacggccacagcgaatggaacgccaagaacctg
ttcaccggctgggtggatgttgacctcaacgaccagggccgcgaggaagcggctcgcggt
ggtgagctcctggtcgagaacaatgttctcccggacgtcctctacacctccctcctgaag
cgggccatcaacacggcaaacatcgccctggacaaggccgaccgcggctggattccggtc
aagcgcgactggcgcctgaacgaacgccactacggcgccctgcagggcaaggacaaggcc
cagacgctggccgaatacggtgaagagcagttcatggagtggcgccgttcctacgacacc
ccgccgccgcccctggacgacgacagcgagttctcccaggcgcacgacccccgctacgcc
gacctgggcgacgcgctcccgcgcaccgagtgcctgaaggacgtcctcatccgcctgatg
ccctactgggaatcagacatcaaggaagacctcaaggcgggcaagaccgtcctggtcacc
gcgcacggcaactccctgcgggcgctcgtcaagcacctcgacggcatcagtgacgaagcc
atcgccggcctgaacatccccaccggtattccgctggtctacgacctcgacgagaacttc
aagccgctcaacccgggcggcacctacctcgaccccgaggccgctgccgagtccatcaag
gcagtagcgaaccagggtaagaagtaa

DBGET integrated database retrieval system