KEGG   Arthrobacter sp. FB24: Arth_0739Help
Entry
Arth_0739         CDS       T00421                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
art  Arthrobacter sp. FB24
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arth_0739
Enzymes [BR:art01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Arth_0739
Exosome [BR:art04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arth_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
788170..791844
Genome map
AA seq 1224 aa AA seqDB search
MTQSTLDPSLVELLRGWLPRQRWFPVKTGDFTLSPVGGVRLDDGSGEVGLEVFLAAVTYS
TADGGSRTDVVQVPLSYRVEPLKGKEAALVGEGGDATHERRWIYDAVHDPVFVSAWLELM
RSGGTSPEGKAVGHLVPSDYRLPTATGTVKVLSGEQSNSSVIVDDGGSAAIVKFFRVLSE
GRNPEVEIGAALTQARTSEVPATLGWVTGEWQAPLDAAGDTPRTVKGELAVAHEFLAGGR
DAWRLAVDAASSGTDFTSEAHALGVATATVHRRLAEALGLAAESAPGKDIAPGVAQRVRQ
SWAEAGPAVGHYDDALAGLLTQLEGSNAGALQRIHGDLHLGQILQVPGHQGEPERWAILD
FEGEPLRPIAERNFPDVPLRDVVGMLRSFDYAAGAAEREREGVHVPGSWVDACAEAFLAG
YGEITPGTIDRGSPLFVALWLDKALYEVVYELRNRPGWLDIPVNASRRLLSSTGSGASAV
AAAEGNKMTGSARTDRPGAPLQVDPDTLAKVASGEYHAPHSVLGAHLDDHGHVTVRTVKH
LAAAVSVVTAAGSVPMTHEADGVWAAVLEPLQPGHVPDYRLEVTYEGVPPQATDDPYHYL
PTVGEVDLHLIGEGRHEKLWEVLGAHVQHYKSSLGDVDGVSFAVWAPNAQAVRVKGDFNA
WDGRENSMRSLGSSGVWELFIPGVLAGACYKFEIKTKAGHWVEKADPLAFGTEVPPLTAS
RVVESAYAFKDEEWMAARAERDPHNSPMSVYEVHLGSWRLGLGYRELAKELVEYVKWLGF
THVEFMPVAEHPFGGSWGYQVTSYFAPTSRFGHPDEFRFLVDALHQEGIGVLLDWVPAHF
PKDAWALAQFDGEPLYEHADPNLGEHPDWGTLIFDFGRTEVRNFLVSNALYWLDEFHIDG
LRVDAVASMLYLDYSREEGQWQPNRYGGRENLEAISFLQEANATVYKTHPGAVMIAEEST
AFPGVTAPTSVGGLGFGLKWNMGWMHDSLKYASEDPINRKWHHGTVTFSLVYAFTENFLL
PISHDEVVHGKGSMLRKMPGDRWQQLANLRAFLAYQWAHPGKQLIFMGTEFGQEAEWSEQ
HGLDWYLADIPAHRGIQLLTKDLNELYSSTPALYERDNEPGGFQWINGGDADRNVLSFIR
WDTDGNPLVCAINFSGSPHQGYTLGVPAAGAWQEVLNTDHSSYGGSGVLNQGALTATTEG
QDGQPATLTVTLPPLGAAFFKTAG
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgacccaatccacactcgatccctcgctcgtcgaactgctccgcggctggctaccgcgc
cagcgctggttccccgtcaagacgggtgacttcacgttgtcacccgtcggcggggtgcgc
ctggacgacggcagcggcgaggtgggccttgaagtgttcctcgcggcggtcacctactcc
acggccgacggcggcagccgcaccgatgttgtgcaggtcccgctcagctatcgcgttgag
cccctgaaaggcaaggaggcggcgctggtcggcgagggcggcgacgccacccatgaacgg
cgctggatttacgatgccgtccacgaccccgtgtttgtctcggcgtggctggaactgatg
cgaagcggcggcacctcgccggaaggaaaggccgttggccacctcgtgccctccgactac
cggctgcccaccgccaccgggaccgtgaaggtcctctccggtgagcagtcaaacagttcg
gtgatagtggacgacggcggctccgcggcaatcgtcaaattcttccgtgtgctgtccgaa
ggacggaacccggaagtggaaatcggtgctgccctcacgcaggccaggacatcggaagtg
cctgccactctcggctgggtcacgggggagtggcaagctccgctggacgccgccggggac
acgccgcggaccgtcaaaggcgaacttgccgtcgcccatgagttcctggccggcggccgc
gacgcctggcggctggccgttgatgccgcaagttccggcactgacttcacgtccgaagcc
catgccctgggcgtagcaaccgcaacagtgcaccgacgcctggccgaggcgctgggcctg
gccgcggaatccgcgccgggaaaggacatagctcccggggtagcccagcgcgtacgccag
tcgtgggcggaagccggtcccgccgtcgggcattacgacgatgcacttgccggcctgctc
acccagctggaaggcagcaacgccggggcgctgcagcggatccacggcgacctccacctg
gggcagatcctgcaggtgccggggcaccagggagagccggaacgctgggccatcctggac
ttcgaaggcgagccgctgaggcccatcgcggaacgcaactttccggacgtgccgctgcgc
gacgtcgtcggcatgttgcggtccttcgactacgccgccggtgccgccgaacgcgagcgg
gaaggcgtgcacgtacccggttcgtgggtggacgcctgcgccgaggcgttcctggcgggg
tacggcgaaattacgcccgggaccattgaccgcggctcgcccctgtttgtggcattgtgg
ctggacaaggcgttgtatgaagttgtttatgagttgcggaacaggcccggatggctggac
attccggtgaatgcctcacgacgtctcctcagcagtacaggttccggcgcttcagccgta
gccgcagcggaaggtaacaaaatgacaggctcagcacgtacagaccggcccggtgcgccc
ctccaggtggacccggacacgcttgcaaaggtggcgtcaggcgaataccacgccccgcac
tccgtgctgggcgcgcaccttgacgaccacggtcatgtcaccgtccgcaccgtgaagcac
cttgcagccgccgtgtccgtggtgaccgccgccggttcggtacccatgacgcacgaggcc
gacggtgtctgggctgccgtgctcgaacccctccagccgggccacgtccccgactaccgg
ctggaagtaacctacgagggcgtgcctccgcaggctacggacgatccgtaccattacctg
cccacggtcggtgaagtggacctgcaccttatcggtgagggccgccacgagaaactgtgg
gaagtcctgggcgcgcacgtccagcactacaagtcttcgctcggcgacgtggacggtgtc
tcgttcgcggtgtgggcgccgaatgcacaggctgtcagggtcaaaggtgacttcaacgcc
tgggacggccgggaaaactcgatgcgctccctgggctcatccggcgtctgggaactcttc
atcccgggcgttttagcaggggcgtgctacaagtttgaaatcaagaccaaagccggccac
tgggtggaaaaggccgaccccctggcgttcggaaccgaggtcccgccgcttacggcgtcg
cgcgtcgttgagtccgcatacgccttcaaggacgaggaatggatggcggcccgcgctgag
cgggacccgcacaattcgcccatgagcgtgtacgaggtccacctcggatcctggcgactt
gggctggggtaccgggagctggccaaggaactggtggagtacgtcaagtggctcggattc
acccatgtggagttcatgccggtggcggagcaccccttcggcggctcgtggggctaccag
gtgacatcgtacttcgcgcccacgtccaggttcggccaccccgacgaattcaggttcctc
gtggatgccctgcaccaggaaggaatcggcgtccttcttgactgggtgccggcccacttc
cccaaggacgcctgggccctggcccagttcgacggcgagccgctatacgagcacgccgac
cccaaccttggcgagcacccggactggggcacgctgattttcgacttcggccggacggaa
gtccgcaacttcctggtgtccaacgcgctttactggctggacgagttccacatcgacggc
ctccgggtggatgccgtggcatcgatgctgtacctcgactactcacgcgaggaaggccag
tggcagcccaacaggtacggcggccgcgagaaccttgaggccatctccttcttgcaggaa
gcgaacgcaacggtctacaagacccacccgggcgctgtgatgattgcggaggagtccacg
gcattccccggcgtgaccgccccgaccagcgtcggcggcctgggcttcgggctcaaatgg
aacatgggctggatgcacgactcgctcaagtacgcatccgaagatccgatcaaccgcaag
tggcaccacggaacggtgaccttctcgctggtttacgctttcacggaaaacttcctgctg
cccatcagccacgacgaagtagtgcacggcaaaggctccatgctccggaaaatgcccggc
gaccgctggcagcagctggccaacctccgtgcgttcctggcgtaccagtgggcccatccc
ggtaagcagctgatcttcatgggcactgaattcggccaggaagcggaatggtccgaacag
cacggcctcgactggtatctggcggacatccccgcgcaccgcggcatccagctgctcacc
aaggacctgaacgagctgtactcatcgactccggcactttacgaacgggacaacgaaccg
ggtggtttccagtggatcaacggtggagacgctgaccgcaacgtcctgtcgtttatccgg
tgggacaccgatggcaatccgctggtgtgcgcgatcaacttttccggcagcccgcaccag
ggctacaccctgggcgtgcctgcggccggagcttggcaggaggtcctcaacacggaccac
tccagctacggcggttcgggtgtgctgaaccaaggcgcactcactgccaccaccgaggga
caggacggacagccggcgacgctgaccgttacgctgcctccgctcggtgccgcgttcttc
aagacggccggctga

DBGET integrated database retrieval system