KEGG   Arthrobacter sp. FB24: Arth_0889Help
Entry
Arth_0889         CDS       T00421                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_0889
   01230 Biosynthesis of amino acids
    Arth_0889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0889
   00051 Fructose and mannose metabolism
    Arth_0889
   00562 Inositol phosphate metabolism
    Arth_0889
Enzymes [BR:art01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arth_0889
Exosome [BR:art04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arth_0889
  Exosomal proteins of bladder cancer cells
   Arth_0889
  Exosomal proteins of melanoma cells
   Arth_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
961936..962775
Genome map
AA seq 279 aa AA seqDB search
MQHASASHATDTVNDSVIDCVSDSVIYVGVSTKMYLGYRDTLDWLERLRHEVDSRPALAA
GRVVPFVIPSFPVLPAAAALLTGSPMLLGAQNCGWAEGPWTGEVAPSMLAELGVRLVEIG
HAERRAHLGETDSMVALKVRAADDAGLTPLLCVGEASVGDASDGDAAIATRNAAAFVQGQ
IEAAVGGDWELASRLIIAYEPVWAIGAAEPADPGYVSDVVNHLRGLLAAHGLRELPVIYG
GSAKPGLLPELGGVSGLFLGRFAHDAGNFGAVLDEALAG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgcttcagccagccacgccacggacaccgtcaatgacagcgttattgactgt
gtcagtgactccgtcatctatgtcggcgtcagcaccaagatgtacctgggctaccgggac
accctggactggctggagcgcctgcggcacgaagtggactcccgtccggccctcgcggcc
gggcgggttgtcccgtttgtgatcccgtccttcccggtgctgccggcggccgccgctctt
cttacgggttcgccaatgctgctcggcgcgcagaactgcggctgggccgagggcccgtgg
accggcgaggtggccccgtccatgctcgccgagctcggtgtgcgcctggtggagatcggc
cacgccgaacgccgcgcgcacctcggcgaaaccgactccatggtggcgctcaaggtccgg
gccgcggacgacgccgggctgacgcccctgctgtgcgtcggcgaggcctccgtgggggac
gcgtccgacggcgacgccgccattgctacccggaacgccgcagcctttgtacaagggcag
atcgaggctgccgttgggggcgactgggaactggcctcgcgcctcatcatcgcttacgag
cccgtctgggccatcggcgccgccgaaccggcggatcccggttatgtgtccgacgtcgtc
aatcacctccgcggcctgctcgccgcgcacgggttgcgggagcttcccgtcatctacggc
ggctcagccaagccggggctgctgcccgaattgggcggcgtttccggtttgttcctgggc
cgcttcgcacacgacgccgggaacttcggcgcggttctggacgaggcgctggctgggtga

DBGET integrated database retrieval system