KEGG   Arthrobacter sp. FB24: Arth_0889Help
Entry
Arth_0889         CDS       T00421                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00051  Fructose and mannose metabolism
art00562  Inositol phosphate metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
art01230  Biosynthesis of amino acids
Module
art_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
art_M00002  Glycolysis, core module involving three-carbon compounds
art_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_0889
   00051 Fructose and mannose metabolism
    Arth_0889
   00562 Inositol phosphate metabolism
    Arth_0889
Enzymes [BR:art01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arth_0889
Exosome [BR:art04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arth_0889
  Exosomal proteins of bladder cancer cells
   Arth_0889
  Exosomal proteins of melanoma cells
   Arth_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Rab15_effector
Motif
Other DBs
NCBI-ProteinID: ABK02287
JGI: Arth0889
UniProt: A0JTB7
Position
961936..962775
Genome map
AA seq 279 aa AA seqDB search
MQHASASHATDTVNDSVIDCVSDSVIYVGVSTKMYLGYRDTLDWLERLRHEVDSRPALAA
GRVVPFVIPSFPVLPAAAALLTGSPMLLGAQNCGWAEGPWTGEVAPSMLAELGVRLVEIG
HAERRAHLGETDSMVALKVRAADDAGLTPLLCVGEASVGDASDGDAAIATRNAAAFVQGQ
IEAAVGGDWELASRLIIAYEPVWAIGAAEPADPGYVSDVVNHLRGLLAAHGLRELPVIYG
GSAKPGLLPELGGVSGLFLGRFAHDAGNFGAVLDEALAG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgcttcagccagccacgccacggacaccgtcaatgacagcgttattgactgt
gtcagtgactccgtcatctatgtcggcgtcagcaccaagatgtacctgggctaccgggac
accctggactggctggagcgcctgcggcacgaagtggactcccgtccggccctcgcggcc
gggcgggttgtcccgtttgtgatcccgtccttcccggtgctgccggcggccgccgctctt
cttacgggttcgccaatgctgctcggcgcgcagaactgcggctgggccgagggcccgtgg
accggcgaggtggccccgtccatgctcgccgagctcggtgtgcgcctggtggagatcggc
cacgccgaacgccgcgcgcacctcggcgaaaccgactccatggtggcgctcaaggtccgg
gccgcggacgacgccgggctgacgcccctgctgtgcgtcggcgaggcctccgtgggggac
gcgtccgacggcgacgccgccattgctacccggaacgccgcagcctttgtacaagggcag
atcgaggctgccgttgggggcgactgggaactggcctcgcgcctcatcatcgcttacgag
cccgtctgggccatcggcgccgccgaaccggcggatcccggttatgtgtccgacgtcgtc
aatcacctccgcggcctgctcgccgcgcacgggttgcgggagcttcccgtcatctacggc
ggctcagccaagccggggctgctgcccgaattgggcggcgtttccggtttgttcctgggc
cgcttcgcacacgacgccgggaacttcggcgcggttctggacgaggcgctggctgggtga

DBGET integrated database retrieval system