KEGG   Arthrobacter sp. FB24: Arth_1010Help
Entry
Arth_1010         CDS       T00421                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
art  Arthrobacter sp. FB24
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arth_1010
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Arth_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1087885..1088757)
Genome map
AA seq 290 aa AA seqDB search
MSTRLPAVTVVGSINLDIIATTDRIPSPGETVGGGALTHQPGGKGANQAVAAARLGVSSR
MIGAVGDDASGRLMLESLSGAGVDTTDVAVLDGDATGTALIVVDRDGENQIVVCPGANAA
FSLEGVEFGPDETVLCQLEVGLPVVLEAARRSAGFFVLNAAPAMDLPAELLDRCDLVIVN
ETEYQLIPALASAKLVAVTYGKDGAAMFERGLRVAEAPASVVTVANTIGAGDAFCAALVL
ALEAGLNYSTALAVANAVGADAVGDPSSQPALAPLGEYVARVAEAGVAAR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgacttcctgccgtcaccgtcgtcggcagcatcaacctcgacatcatcgcg
accacggacaggattccctccccaggtgagaccgtcggcggcggcgctctgacccatcag
ccgggcggcaagggagccaaccaggcggtggccgctgcccgtctgggcgtcagctcgagg
atgatcggggccgtgggcgatgacgcctccggccgcctgatgctggagtccctttccggc
gcgggagtggacaccactgatgtggcggtgctcgacggcgacgcgacgggcaccgcgctg
atcgtggtggaccgcgacggcgagaaccagattgtggtctgcccgggggcgaacgctgcg
ttttcgctggagggtgtggagttcgggccggacgagacggtgctgtgccagctcgaagtg
ggcctgcccgtggtattggaagccgcccggcgttccgccggtttcttcgtcctgaacgcc
gcgccggcgatggacctgccggcggagctgctggaccggtgcgacctggtgatcgtcaac
gagaccgagtaccagctgattccggcgcttgcttccgcgaaactcgtggcggtgacgtac
ggaaaggacggggcggcgatgttcgagcgcggtctgcgggtggccgaggcgcctgcctcc
gtggtgacggtggcgaacacgattggtgcgggtgacgccttctgcgcggctttggtgctg
gctctcgaggcggggctcaactactccacggcgctggccgtggccaatgccgtgggggcg
gatgctgtgggcgatccctcttcgcagccggcgctggcgccgctgggcgagtacgttgcc
cgggtggctgaagccggggttgctgcgcggtga

DBGET integrated database retrieval system