KEGG   Arthrobacter sp. FB24: Arth_1057Help
Entry
Arth_1057         CDS       T00421                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arth_1057
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Arth_1057
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Arth_1057
Enzymes [BR:art01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Arth_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1136171..1137811
Genome map
AA seq 546 aa AA seqDB search
MGSMTAFTRRNVLKGALAAAGAAAVVPAALSTGSTPAHAGVALVRNRLTLPSGIATGDVT
ADSGVLWSRASGPGRLVAGLLAVDDDGAPLRGGRAFQRVLRGSAASEATDFTSRINAEHL
PAGTRFALTLHFEDAEGNAGETAQGSFRTAPGTGLISSGRAARKQSFVWTGDTAGQGWGI
NEEIGGMRGYAAMHATRPDFFIHSGDTIYADGPIAAQVTEPDGQIWRNLVTEEVSKVAET
LNEFRGRHRYNLMDRNVRALYAEVPVIAQWDDHETHNNWYPGEVITDPRYTERRVDVLAA
RGRQAWQEYQPVSGLSTRIGDGSTGFEPARIYRKISRGPQLDVFCLDMRTFKDPNTDGKE
THLTHILGQEQAEWLIREVSKSKATWKVISADLPLGLIVPDGPVNQESLANRDAGAPLGK
ELEIAGVLSAFKRNRVKNVVWLTADVHYCAAHHYSPERAAFTDFDSFWEFVAGPINAGSF
GPGELDGTFGPERVFYKTGAYANQSPRTGENQFFGHVDLNEDDVFTVSLRNANGTVLWNK
ELQPAR
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatgactgctttcacccgccgtaatgtcctcaaaggtgccctggcagccgcc
ggtgccgccgccgtcgtgcccgccgcgctttcgacaggctcaacccccgctcacgccggc
gtcgcgctggtccgcaaccgactgaccctcccgtccgggatcgccaccggcgatgtcacc
gccgattccggcgtgctgtggtcccgcgcgtcgggcccgggccggctggtggccggcctg
ctcgccgtggacgacgacggtgcccccctccgcggcggccgcgccttccagcgcgtgctg
cgggggagcgccgccagcgaagccaccgacttcacgtcccggatcaatgccgagcacctc
cccgccggcacccgcttcgcgctcaccctgcacttcgaggacgccgagggcaacgccggc
gaaaccgcgcagggctccttcaggaccgcccccggaaccggactcatcagcagcggccgt
gcagcccgcaagcagagcttcgtctggaccggcgacaccgccggccagggttggggcatc
aacgaggagatcggcggcatgcgcggctacgcggccatgcacgccaccaggccggacttc
ttcatccactccggcgacacgatctacgccgacggccccatcgccgcgcaggtcaccgag
ccggacgggcagatctggcgcaacctcgtcaccgaagaagtgtccaaggtggccgagacc
ctcaacgagttccgcggacggcaccgttacaacctcatggaccggaacgtccgcgccctg
tacgccgaggtgccggtgatcgcccagtgggacgaccacgaaacgcacaacaactggtac
cccggcgaggtcatcaccgacccccgctacaccgaacgccgcgtggacgtgctcgccgcc
cgcggccgccaggcctggcaggaataccagcccgtctccggcctcagcacccggatcggc
gacggcagcacgggctttgaacccgcccggatctaccgcaagatctcccgcggcccccag
ctggacgtgttctgcctggacatgcgcaccttcaaggaccccaacaccgacggcaaggaa
acgcacctcacccacatcctgggccaggaacaggcggaatggctcatccgcgaagtcagc
aagtccaaggccacctggaaggtcatttccgccgaccttccgcttggcctgatcgtcccg
gacggcccggtcaaccaggagtccctggccaaccgcgacgccggcgcccccttgggcaag
gaactcgagatcgcgggggtgctctcggcgttcaagcgcaaccgggttaaaaacgtggtg
tggctcacggccgacgtccactactgcgccgcccaccactactcgcccgagcgcgccgcg
ttcaccgatttcgactccttctgggaattcgtggccggccccatcaacgccggcagcttc
ggccccggcgaactggacggcaccttcggtcctgagcgggtgttctacaagaccggcgcc
tacgccaaccagtccccgcgcaccggagaaaaccagttcttcggccacgtggacctgaac
gaggacgacgtcttcaccgtcagcctccgcaacgccaacggcaccgtcctctggaacaag
gagctccagccggcgcggtag

DBGET integrated database retrieval system