KEGG   Arthrobacter sp. FB24: Arth_1130Help
Entry
Arth_1130         CDS       T00421                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
art  Arthrobacter sp. FB24
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_1130
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arth_1130
   00650 Butanoate metabolism
    Arth_1130
  Energy metabolism
   00190 Oxidative phosphorylation
    Arth_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1226695..1227189)
Genome map
AA seq 164 aa AA seqDB search
MTATIQSPRSGKDGGKPGAGLIAPKYRRSGASKGNFEMAAWLFMRLSGVVLVVLIFGHLF
VNLMVGEGIHAIDFGFVAGKWADPFWQFWDLAMLWLAMLHGTNGVRTIINDYAEKDSTRF
WLKIVLYAATAVIIILGTLVIFTFNPCPLDVNGVPLPGGFCPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccattcagagtccccgcagtggaaaagacggcggcaagccgggcgcagga
ctgattgcccccaagtaccgccgcagcggcgcttccaagggcaacttcgaaatggctgcc
tggctgttcatgcggctttcgggcgttgtcctggtagtcctgatcttcgggcacctgttc
gtcaacctcatggtaggcgagggcatccatgccattgacttcggtttcgtggccggcaag
tgggccgatccgttctggcagttctgggacctggccatgctctggcttgccatgctgcac
ggcacgaacggtgtccgcaccatcatcaacgactacgccgagaaggattccacacgcttc
tggctgaagatcgtcctttacgccgcaacggctgtcatcatcatcctgggcaccctggtg
atcttcaccttcaacccgtgcccgctggacgtcaacggcgtaccgctgcccggcggcttc
tgccccgcagcctag

DBGET integrated database retrieval system