KEGG   Arthrobacter sp. FB24: Arth_1255Help
Entry
Arth_1255         CDS       T00421                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
art  Arthrobacter sp. FB24
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1385932..1388601)
Genome map
AA seq 889 aa AA seqDB search
MEPVVQGDDDPAESVDAVVVGSGFGGSVASYRLAAGGQSVVLMERGRAYPPGSFARTPSE
MGRNFWDPDKGLYGLFDAWTFRGLEGIVSSGLGGGSLIYANVLLRKDKNWFVQESPVPGG
GYESWPFSRQDLEPYYDAAEAMLRPVPYPYRDTPKTLAMEAAARALGLSITRPPIAVTFA
ASPGAAPARNQVLPPAPYGSVHGEGTVRTTCTLSGECDIGCNTGAKNTLDHNYLSAAKAA
GADIRTHHDVRGIRPLPGGGYEVRYVVHDPADTAPGLLREQLIHCRRLILAAGTFGTTFL
LLRNRASLPALSPALGTRFSGNGDLLGFVLDAKDPDGVTRTLSGSVGPVITTAIRTPDST
DGGDGRGYYIEDAGYPSFMNWLLETGQFRQVAKRAGKVMVQLLKDRLFQAQRSNISADLA
AALGDGRLSASSVPLLGMGRDIPDGVMTLQGGRLAINWTLATSAAYFGRMQATMQAIATE
LGGSFKQNPLWWSKRVITVHPLGGAPAGRNSSEGVCDSYGEVFGYPGLHVVDGAVMPGPV
GANPALTIAAFAERACDRILNGTGADRQRGGLDTPGFPPGNTGGVTFDDGITGYQPGPLR
ALVPDATKGAKAPAEEGTFVPRAASRSLGLPSAVSPEVGISPEMMLPESEALQEAEIEEE
TELAETGPSSVSFTEQMHGWFSAGVTDPEEGRSLGRDRSRRMMFELTITAADIDEFVRDP
LHPATAEGYVLADQFGGRLPVERGWFNLFVKDGPEPAGRKMLYRLWLRDPGGTPLTFVGH
KDVRNDAGFDVWGDTTTLYVTVLRGHVPSPDPKLPVSTAPQAAAPHGPAVVAGAGMLFIR
PWDFARQLTTFRVAGPNPASALAAFGKVFLGELWQVYGRRIHGRSAGRQ
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccggtggtgcaaggcgacgatgatcccgcggagtcggtggacgccgtggtggtg
ggctccggcttcggcggatcggtagcgtcctaccggttggcggccggcggccagtccgtg
gtcctgatggaacggggcagggcctacccgccgggaagcttcgccaggacaccgtccgag
atgggccggaatttctgggatccggacaagggcctgtacggtctctttgatgcctggacc
ttcaggggcctggaaggaattgtctccagcggcctgggcggcggatccttgatctacgcg
aacgtgctgctgcgcaaggacaagaactggtttgtccaggaatcccccgttcccggcgga
ggctacgaaagctggccgttcagcaggcaggacctcgagccctattacgatgccgccgaa
gccatgctccgccccgtgccctacccttaccgggacacccccaagaccctggccatggaa
gccgccgcgcgcgcactcggactcagcatcacgcgaccgcccatcgccgtcacctttgcg
gcttcccctggtgcggctcccgcaaggaaccaggtgctgccgcccgccccgtatggaagc
gtccatggcgaggggacggtccgcaccacctgcaccctctccggcgaatgcgacatcggg
tgcaacaccggcgccaagaacaccctggaccacaactacctgtccgcggccaaggctgcc
ggcgcggacatccggacccaccacgacgtccgcggcatccgtccccttccgggaggcggc
tatgaagtccgatacgtcgtccacgatcccgccgacaccgcgcccgggctcctgcgcgaa
cagctaatccactgccgccggctcatcctcgccgccggaacgtttggcaccacgttcctg
ctgctgcgcaaccgcgcctcgcttcccgcgctgagccccgcactgggcaccaggttcagc
gggaacggggacctgctgggcttcgtcctggacgccaaggaccccgacggcgtcacgcgc
acgctgtcgggcagcgtggggccggtcatcaccacggctatccgcacgcccgactccacc
gacggcggcgacggccgcgggtactacatcgaagacgcaggctacccgtcgttcatgaac
tggctcctggaaaccggacagttccgccaggtggcgaagcgcgcgggcaaagtgatggtg
cagctcctcaaggaccggctcttccaggcccagcgctccaacatctccgccgatcttgcc
gcggccctgggagacggccggctgtcagcgtcctccgtgcccctgctcggcatgggccgg
gacataccggacggcgtgatgaccctccagggcggccggctggccatcaactggaccctc
gccacctcggccgcgtacttcggccggatgcaggccacgatgcaggcgatcgccacggaa
ctgggcgggagcttcaagcagaatccgctctggtggagcaaacgggtcatcaccgtgcat
ccgctgggcggcgccccggcaggacggaacagcagcgaaggcgtgtgcgattcctacggt
gaggtctttggctaccccgggctgcacgtggtggacggagccgtgatgcccggtccggtg
ggagccaaccccgccctgaccatcgccgcatttgccgaacgggcctgcgaccggatcctg
aacggaacgggagcggaccggcagcgcggcggcctggacactcccgggttcccgcccggc
aataccggcggcgtgactttcgacgacgggattaccggctaccagccggggccgcttcgc
gccttggtgcccgacgccacgaaaggtgccaaggccccggccgaagaaggcacgttcgtc
ccgcgggccgccagccgctcgctgggcctgccatccgcagtatccccggaggtgggcatc
tcccccgaaatgatgctccccgaaagcgaggcactgcaggaagctgagatcgaggaggaa
accgaactggccgaaacagggccgtcctccgtcagcttcaccgaacagatgcacgggtgg
ttcagcgccggcgtcacggaccctgaggagggacgcagcctgggccgtgaccgcagccgc
cggatgatgttcgaactcaccatcacggccgctgacattgacgagttcgtgcgtgatccg
ctccatccggcaactgctgagggctacgtcctggccgaccagttcggcggccgcctgcca
gtggaacggggctggttcaatctcttcgtcaaggacggccctgaacctgccggccggaag
atgctctaccggctctggctgcgcgatccgggcggcactccgctgactttcgtgggccac
aaggacgtccgcaacgatgcaggcttcgacgtctggggtgacaccaccacactgtacgtc
accgtcctgcgcgggcatgttccgtccccggacccgaagctgccggtctcaaccgctccg
caggcggccgccccgcacggccccgccgtggtggcgggcgcagggatgctgttcatccgg
ccgtgggacttcgcccggcaactgacaacgttccgcgtcgcgggaccgaaccctgcgagc
gccctggcagcattcggcaaggtctttcttggcgagctctggcaggtgtacggccgccgg
atacacggccggtccgccggccggcagtga

DBGET integrated database retrieval system