KEGG   Arthrobacter sp. FB24: Arth_1320Help
Entry
Arth_1320         CDS       T00421                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Arth_1320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_1320
  Lipid metabolism
   00071 Fatty acid degradation
    Arth_1320
  Amino acid metabolism
   00350 Tyrosine metabolism
    Arth_1320
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Arth_1320
   00626 Naphthalene degradation
    Arth_1320
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Arth_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1482167..1483285
Genome map
AA seq 372 aa AA seqDB search
MRAAVLYATVPAGTSYTEARPLVVQELDRPEPRAGELGVAITYSSLCHSDLSVVDGSRVR
PLPMALGHEAVGRVVSVGEGVHDVAVGEHVVLVFVPSCGDCRACRSGRPALCHRAAEVNA
SGDLLHGAALLRTPSGERINHHLGVSAFADYAVVARESVVVIDDDVPDTVAAMFGCAVLT
GMGAVLNTAAVTAGQSVAVFGLGAVGLSAVMAASLAGAAAIIAIDPNEGKHQLARDCGAT
AVGTPDDAARLVAEATGDGVDVAVEAVGSAGVIASCLELVTRGGAVVSVGLPKPSAELTV
GALQFAGAGKRLLGSYMGDAVPEREIPLYLDYWRSGRLPVELLHTDTRPLAEINEGLDAL
AAGQVVRRLFQA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcagtcctgtacgccaccgtccccgccggaaccagctataccgaagcacgc
ccgttagtggtgcaggagcttgaccggcccgaaccccgcgccggcgaactgggggtggcc
atcacctactccagcctgtgccactcggacctgtccgtggtggacggctcccgggtccgg
ccgctgcccatggccctggggcatgaggccgtgggccgggtggtgtcggtcggtgagggc
gtccatgacgtggctgtgggcgagcacgttgtgctcgtcttcgtccccagctgcggcgac
tgccgggcgtgccgctccgggcgaccggccctgtgccaccgcgccgccgaagtcaacgct
tcaggggacctgctgcacggggcggcgctgctgcgcacgccgtcgggggagcggatcaac
caccatctcggcgtgtcggcctttgcggactacgccgtggtggcgcgggaatcagtagtg
gtaatcgacgacgacgtcccggacaccgtcgcagccatgttcggctgcgccgtactcacc
ggaatgggcgccgtgctgaacacggcggcggtcaccgccggacagtcggtggcggtcttc
gggctcggcgccgtcgggctttccgccgtgatggcggcgtccctggccggcgccgcggcc
atcatcgccatcgaccccaacgaaggcaagcaccagctcgcccgggactgcggcgccacg
gcagtgggaactcccgacgacgccgcccggctggttgccgaggcgaccggcgacggcgtg
gacgtcgccgtcgaagccgtgggatccgcgggagtcattgcctcgtgcctggagctcgta
acgcgcggcggcgccgtcgtctccgtcgggctgccgaagccttcggcggaattgaccgtc
ggagccctgcagtttgccggagcggggaagcggcttctcggctcctatatgggggatgcc
gtcccggagcgggaaattccgctgtatcttgactactggcggtccgggcggctcccggtg
gaactgctgcatacggacaccaggccgctcgcggaaatcaacgaaggccttgacgccctg
gccgcagggcaagtggttcgccggctgttccaggcatag

DBGET integrated database retrieval system