KEGG   Arthrobacter sp. FB24: Arth_1548Help
Entry
Arth_1548         CDS       T00421                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_1548
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_1548
   00052 Galactose metabolism
    Arth_1548
   00500 Starch and sucrose metabolism
    Arth_1548
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_1548
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arth_1548
   00524 Butirosin and neomycin biosynthesis
    Arth_1548
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arth_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1725726..1726817
Genome map
AA seq 363 aa AA seqDB search
MHTPSPGDLPRPYRRTAAWRRRKPSGQDALAASQGFREHLRLGRKGLAIGVDIGGTKVAA
GVVDADGRILSQARRSTPGNDPRAVEQVIVELVEELSRGHRIWSVGIGAAGWMDLDGGTV
LFSPHLAWRNEPLRDNLQRLLRRPVLLTNDADAAAWAEWRFGAGQGQSRLVCITLGTGIG
GAMVMDGRLERGRFGVAGEFGHQIIMPGGHRCECGNRGCWEQYASGNALGREARELAAAN
SPVAQELLKAVDGQVDRITGAIVTELAKAGDPTSRELLEDVGEWLGLGLANLAAALDPGK
FVIGGGLCDAGELLVAPARKAFARNLTGRGFRPAAEIALAALGPNAGLIGAADLSRVSSR
MHG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaccttcgcccggcgacctgcccagaccctaccgacggacggccgcgtggcgg
cgcaggaagccttccgggcaggatgcgctggccgccagccagggcttccgggagcacctc
cggctcgggcgcaaagggttggcgatcggtgtggacatcggaggcaccaaggtcgcggcc
ggtgtggtggacgccgacggccggatcctcagccaggccaggcgctccacacccgggaac
gacccccgggccgtggaacaggtgatcgtcgaactcgtggaggagctgagccgcggccac
cgcatctggtcggtgggaatcggcgcggccgggtggatggacctcgacggcggcacggtg
ctgttcagcccgcacctcgcgtggcgcaacgaaccgttgcgggacaacctccagcgactg
ctgcgccgtccggtcctgctgaccaacgacgccgatgccgccgcgtgggcggaatggcgc
tttggtgccgggcaggggcaaagcaggctcgtctgcatcaccctgggcacggggatcggc
ggtgccatggtgatggacggccggctggaacgcggccgctttggggttgcgggagaattc
ggccaccagatcatcatgcccggcgggcaccgttgcgaatgcggaaaccgcggctgctgg
gaacagtatgcgtctggaaacgcgctgggccgcgaagcccgcgaactggctgctgccaat
tcgcccgtggcgcaggaactcctgaaggccgtggacggtcaggtggaccgcatcaccggg
gccatcgtgacggaactggccaaggcgggggaccccacgtcccgggaactgctggaggac
gttggggagtggctgggcctggggctggccaacctggctgccgcgctggaccctggaaag
ttcgtcatcggtggaggcctgtgcgatgcgggtgaactgctggtggcgccggcacggaag
gcctttgcgcggaacctgacagggcgcggattccggccggctgccgaaatcgcgctcgca
gccctgggccccaacgccgggctgatcggggccgcagacctgtcccgtgtcagcagcagg
atgcacggctga

DBGET integrated database retrieval system