KEGG   Arthrobacter sp. FB24: Arth_1548Help
Entry
Arth_1548         CDS       T00421                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00052  Galactose metabolism
art00500  Starch and sucrose metabolism
art00520  Amino sugar and nucleotide sugar metabolism
art00521  Streptomycin biosynthesis
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
art_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_1548
   00052 Galactose metabolism
    Arth_1548
   00500 Starch and sucrose metabolism
    Arth_1548
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_1548
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arth_1548
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Arth_1548
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arth_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ABK02942
JGI: Arth1548
UniProt: A0JV72
Position
1725726..1726817
Genome map
AA seq 363 aa AA seqDB search
MHTPSPGDLPRPYRRTAAWRRRKPSGQDALAASQGFREHLRLGRKGLAIGVDIGGTKVAA
GVVDADGRILSQARRSTPGNDPRAVEQVIVELVEELSRGHRIWSVGIGAAGWMDLDGGTV
LFSPHLAWRNEPLRDNLQRLLRRPVLLTNDADAAAWAEWRFGAGQGQSRLVCITLGTGIG
GAMVMDGRLERGRFGVAGEFGHQIIMPGGHRCECGNRGCWEQYASGNALGREARELAAAN
SPVAQELLKAVDGQVDRITGAIVTELAKAGDPTSRELLEDVGEWLGLGLANLAAALDPGK
FVIGGGLCDAGELLVAPARKAFARNLTGRGFRPAAEIALAALGPNAGLIGAADLSRVSSR
MHG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaccttcgcccggcgacctgcccagaccctaccgacggacggccgcgtggcgg
cgcaggaagccttccgggcaggatgcgctggccgccagccagggcttccgggagcacctc
cggctcgggcgcaaagggttggcgatcggtgtggacatcggaggcaccaaggtcgcggcc
ggtgtggtggacgccgacggccggatcctcagccaggccaggcgctccacacccgggaac
gacccccgggccgtggaacaggtgatcgtcgaactcgtggaggagctgagccgcggccac
cgcatctggtcggtgggaatcggcgcggccgggtggatggacctcgacggcggcacggtg
ctgttcagcccgcacctcgcgtggcgcaacgaaccgttgcgggacaacctccagcgactg
ctgcgccgtccggtcctgctgaccaacgacgccgatgccgccgcgtgggcggaatggcgc
tttggtgccgggcaggggcaaagcaggctcgtctgcatcaccctgggcacggggatcggc
ggtgccatggtgatggacggccggctggaacgcggccgctttggggttgcgggagaattc
ggccaccagatcatcatgcccggcgggcaccgttgcgaatgcggaaaccgcggctgctgg
gaacagtatgcgtctggaaacgcgctgggccgcgaagcccgcgaactggctgctgccaat
tcgcccgtggcgcaggaactcctgaaggccgtggacggtcaggtggaccgcatcaccggg
gccatcgtgacggaactggccaaggcgggggaccccacgtcccgggaactgctggaggac
gttggggagtggctgggcctggggctggccaacctggctgccgcgctggaccctggaaag
ttcgtcatcggtggaggcctgtgcgatgcgggtgaactgctggtggcgccggcacggaag
gcctttgcgcggaacctgacagggcgcggattccggccggctgccgaaatcgcgctcgca
gccctgggccccaacgccgggctgatcggggccgcagacctgtcccgtgtcagcagcagg
atgcacggctga

DBGET integrated database retrieval system