KEGG   Arthrobacter sp. FB24: Arth_1551Help
Entry
Arth_1551         CDS       T00421                                 

Definition
putative esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
art  Arthrobacter sp. FB24
Brite
Enzymes [BR:art01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Arth_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1728192..1728980)
Genome map
AA seq 262 aa AA seqDB search
MRESSKQTVPAAFSYPGHGPNARIGVAICHGFTGSPLSVMPWALHLAEQGFAVSVPLLPG
HGTHWRELARSGWREWAGAFENAYLELAGRTDACYVAGLSMGGAVALRTASRHRVAGVAV
VNPGLSFYDRRVRIVGVLKYFQPTTLPIVEANPTAATTEDGDYSQTPLSAVHQLKKLFAA
ARRGLPRVTAPVLVFKSDTDEVVPPSSLELIRRRLGSAELRVVPLPNSGHVATLDNDAPA
IFGHSTTFFHEHAPHHVSSETS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaagcagcaaacagactgtgcctgccgctttcagctaccccggccacggaccc
aacgcccggatcggcgtcgccatctgccacggcttcaccgggagtccgctcagcgtcatg
ccgtgggcactccacctggcggagcaagggtttgccgtctccgtcccgctcctgcccggg
cacgggacccactggcgcgaactggcccggtcgggctggcgtgaatgggccggcgcattc
gagaacgcctaccttgaactcgcgggccggaccgacgcctgttacgtcgccgggctctcg
atgggcggcgctgtcgcgctgcgcacggcgtcacgccaccgtgttgccggtgtagccgtg
gtcaatcccggactcagtttctacgaccggcgggttcgtattgtcggcgtcctgaagtac
ttccaaccgaccacgctgccgatagtggaggccaaccccacagctgccaccactgaggac
ggcgactattcgcagacgccgctctccgccgtccatcagctgaagaaactgtttgccgcc
gcccgccgtggattgccccgtgtgacggccccggtcctggtcttcaagtcggacaccgac
gaggttgtgccgccgtcgtcgctcgagctgatccggaggcgcctggggtcggccgaactt
cgcgtggtgccgctgcccaacagcggccacgtggccacgctggacaacgatgcgcccgcg
atcttcgggcattccaccaccttcttccatgagcacgcaccgcaccacgtatcctcggag
acatcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system