KEGG   Arthrobacter sp. FB24: Arth_1565Help
Entry
Arth_1565         CDS       T00421                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
art  Arthrobacter sp. FB24
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:art00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:art00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1743934..1745586
Genome map
AA seq 550 aa AA seqDB search
MSEHHAPGSTDTTSGRVPGSGFRPTAVAAVPLGTIGESVGVVVPGASSSVPVTGISLNSR
TVQPGDLYVALPGAARHGADFVSQAVAAGAVAVVTDDDGARLLALSADTPVPVLVVDEPR
SAVGGLAALIYQSRPEGGTSPSLFGVTGTNGKTTTTYFINALLQALGRRTGLIGTIEILA
GGAPIPSLLTTPESTDLHALLALMRERGLDAASMEVSSHAVSFHRVDGVQFDVAGFTNLT
QDHLDLHGTMDEYFQTKARLFTPRHAKSAVITVDDEWGRRLASAAGIPVTTLATAQGNDP
AAPAADWTVTAAAPRGLGTEFRLRHRDGSELRVHTGLPGSFNVSNAALATVMVLASGVEP
ATLQAALDEADPFTVAVPGRMQLVSTAPAAVVDFAHNPDALQRALEAVRSTEPGSRVIVV
FGATGQRDQGKRPAMGAIAARLADVVIISDDDPHDEDAAAIRADVLAGAREAKESGGLGC
TILESYPRDVAIREAVNMAQPQDTILVAGRGHEVWQEVKGVNLALDDRVELREALTARGF
TVLNDERIES
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagagcaccatgccccaggcagtaccgatacaacgagcggcagggttcccggttca
gggttccggccgaccgccgttgccgcggtgccccttggcaccatcggcgagtccgtcggc
gtcgtcgttcccggggcatccagctccgtccccgtcaccgggatttccctgaactcgagg
accgtgcagccgggcgatctctatgtcgccctgcccggcgccgccaggcatggcgcggac
ttcgtgtcgcaggccgtcgcggcaggcgccgtcgcggtagtgacggacgacgacggcgcg
aggctgcttgcgttgtcagcggacactcccgtaccggtcctggtggttgacgaaccccgc
agcgctgtgggcggcctcgcggcactgatctaccagagcaggccggaaggcggaacttcg
ccgtcgctgttcggtgttaccggcaccaacggcaaaaccaccaccacgtactttattaat
gcgctcctgcaggcgttgggccgcaggaccggcctgatcggcaccatcgagatcctggcg
ggcggtgcccctattcccagcctgctgaccacgcctgagtccaccgaccttcacgcgctt
ctggccctgatgcgcgaacgcggcctggacgctgcgtcgatggaggtttcctcgcatgca
gtatcgttccaccgcgtcgacggggtgcagttcgacgtcgccggcttcaccaacctcacc
caggaccacctggacctccacgggaccatggacgaatattttcagaccaaggcccggctc
ttcacgccccggcacgccaagtctgccgtgatcaccgtagatgatgagtggggccggcgc
ctcgcatccgctgccggcattccggtcaccaccctggcgaccgcccaaggcaacgatccc
gccgcgccggctgctgactggacagtcacggccgccgccccccggggccttggcacggag
ttccggctgcggcaccgtgacggcagcgaactgcgtgttcacacggggctgccgggaagc
ttcaatgtttccaacgccgccctcgcgaccgtaatggtcctggccagcggcgttgagccg
gccacgctgcaggctgccctggacgaggctgatccgttcaccgttgccgttccgggacgc
atgcagctcgtctccacggcgccggccgccgtcgtcgactttgcccataacccggacgcc
ctgcagcgtgcgctggaggctgtgcgttcaaccgagcccggttcgcgggtgatcgtggtc
ttcggcgccaccggacagcgggaccagggcaaacgcccggccatgggggccatcgcggcg
cggcttgcggacgtggtgatcatcagcgatgacgatccccatgacgaggacgccgccgcc
atccgcgcggacgtcctggcgggcgcgcgtgaggcgaaggaatccggcggccttggctgc
acgatcctggaatcctacccgcgcgacgtggcgatccgggaggccgtcaacatggcacag
ccgcaggacacgatccttgtggccggacgcggccacgaagtctggcaggaagtcaaaggc
gtcaacctggcgctcgacgacagggtggagctccgcgaggccttgacagcccgcggattc
accgttctgaatgacgagcggatagagtcctag

DBGET integrated database retrieval system