KEGG   Arthrobacter sp. FB24: Arth_1611Help
Entry
Arth_1611         CDS       T00421                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
art  Arthrobacter sp. FB24
Pathway
art00020  Citrate cycle (TCA cycle)
art00310  Lysine degradation
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00009  Citrate cycle (TCA cycle, Krebs cycle)
art_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arth_1611
  Amino acid metabolism
   00310 Lysine degradation
    Arth_1611
Enzymes [BR:art01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Arth_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H SseB_C
Motif
Other DBs
NCBI-ProteinID: ABK03005
JGI: Arth1611
UniProt: A0JVD5
Position
complement(1793893..1795635)
Genome map
AA seq 580 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPIAGVIEEIL
VAEDETAEVGAPLVRIGDGSGSAGAAEEAAPAEQAPAEEAPAPEEAPSAEAPAPAEAPAA
EAAPAASGESHEVTLPALGESVTEGTVTRWLKAVGDSVEVDEPLLEVSTDKVDTEIPSPV
AGTLQEIRVNEDETAEVGSVLAVIGSGAAAPAAPPAAPAPQQEAPAAEAPKQEAPAAAPA
APAAAPAKEEAPAPKQEAPAAPAAESAAPAESGYVTPLVRKLANQQGVDISSLTGTGVGG
RIRKQDVLAAAEAKAAPAAAAPAASTQGAPASAPTAAESSLRGTVQKAPRIRQVIARRMR
ESLDISTQLTQVHEVDMTKIAKLRLKAKNSFQAQNGVKLTFLPFIAKAVAEALKQHPKVN
AAYDEDKQEITYHNAEHLAIAVDTDKGLLVPVISDAGSLNLAGLAGKIADVAGRTRDGKI
GPDELSGGTFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRPVVVTDENGDDSIAIRS
MMYLSLTYDHRLVDGADAGRFLQTLKARLEAGAFEADLGL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagtgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtaggtgaccgggtagaggtggacgagccgctgctcgaggtttcc
accgacaaagtagacaccgaaatcccctctccgattgctggcgtgattgaggaaatcctc
gtcgccgaagatgagaccgccgaagtcggcgctccgctcgtccgcatcggtgacggctcg
ggttccgccggcgctgccgaggaagctgcccccgcagagcaggcaccggctgaagaagca
cccgcccctgaagaggcgccctccgctgaggcgcccgcaccggctgaagcccccgccgcg
gaggctgcccccgcagcttccggcgaaagccatgaagtcacccttccggctctcggcgaa
tcagtcaccgaaggcaccgtaacccgctggcttaaggccgtcggcgactccgtcgaggtt
gacgagcccctgctcgaggtatccaccgacaaggtggacaccgagatcccgtccccggtg
gctggcaccctgcaggaaatccgcgtcaacgaggacgaaaccgccgaggttggctccgtt
ctggccgttatcggctccggcgctgctgcaccggccgcccctccggcggctccggccccc
cagcaggaagcccccgctgccgaagctccgaagcaggaagcccccgccgcagctcccgcg
gccccggctgccgctcccgccaaggaagaagcaccggctcccaagcaggaagccccggct
gcaccggctgcagaatccgcggccccggccgagtccggctacgtcactcccctggtgcgc
aagctcgccaaccagcagggcgtggacatctcctcgctgaccggcaccggagtgggcgga
cgcatccgcaagcaggacgtgcttgcagccgccgaggccaaggctgctccggccgccgca
gcgccggccgcttccacgcagggtgcccccgcgtctgctccgacggccgccgaatcctca
ctgcgcggcaccgtgcagaaggcaccgcgtatccgtcaggtcattgcccgccgcatgcgt
gagtccctggacatctccacccagctgacgcaggtccacgaagtggacatgactaagatt
gccaagctgcgcctcaaggccaagaactcgttccaggcacagaacggcgtgaagctcacc
ttcctgccgttcatcgccaaggcagtcgcggaggccctgaagcagcacccgaaggtgaat
gctgcctacgacgaggacaagcaggaaatcacctaccacaacgccgagcacctggccatc
gccgtggacaccgacaagggcctccttgttccggtcatctccgacgccggcagcctgaac
ctcgccggcctggccggcaagatcgcagacgtggcaggccgtacccgcgatggcaagatc
ggcccggatgaactgtccggcggcacgttcagcatcaccaacatcggttccgttggcgca
ctgttcgacacgccgatcatcaaccagccgcaggtcggcatcctcggcacgggtgcgatc
gtcaagcgtcccgtggtggtcactgacgaaaacggcgacgactcgatcgccatccgctcc
atgatgtacctctccctgacgtacgaccaccgcctggtggacggcgccgacgcaggacgc
ttcctgcagaccctcaaggcccgcctcgaggccggcgccttcgaggcggacctggggctg
tag

DBGET integrated database retrieval system