KEGG   Arthrobacter sp. FB24: Arth_1611Help
Entry
Arth_1611         CDS       T00421                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
art  Arthrobacter sp. FB24
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_1611
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arth_1611
  Amino acid metabolism
   00310 Lysine degradation
    Arth_1611
Enzymes [BR:art01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Arth_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1793893..1795635)
Genome map
AA seq 580 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPIAGVIEEIL
VAEDETAEVGAPLVRIGDGSGSAGAAEEAAPAEQAPAEEAPAPEEAPSAEAPAPAEAPAA
EAAPAASGESHEVTLPALGESVTEGTVTRWLKAVGDSVEVDEPLLEVSTDKVDTEIPSPV
AGTLQEIRVNEDETAEVGSVLAVIGSGAAAPAAPPAAPAPQQEAPAAEAPKQEAPAAAPA
APAAAPAKEEAPAPKQEAPAAPAAESAAPAESGYVTPLVRKLANQQGVDISSLTGTGVGG
RIRKQDVLAAAEAKAAPAAAAPAASTQGAPASAPTAAESSLRGTVQKAPRIRQVIARRMR
ESLDISTQLTQVHEVDMTKIAKLRLKAKNSFQAQNGVKLTFLPFIAKAVAEALKQHPKVN
AAYDEDKQEITYHNAEHLAIAVDTDKGLLVPVISDAGSLNLAGLAGKIADVAGRTRDGKI
GPDELSGGTFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRPVVVTDENGDDSIAIRS
MMYLSLTYDHRLVDGADAGRFLQTLKARLEAGAFEADLGL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagtgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtaggtgaccgggtagaggtggacgagccgctgctcgaggtttcc
accgacaaagtagacaccgaaatcccctctccgattgctggcgtgattgaggaaatcctc
gtcgccgaagatgagaccgccgaagtcggcgctccgctcgtccgcatcggtgacggctcg
ggttccgccggcgctgccgaggaagctgcccccgcagagcaggcaccggctgaagaagca
cccgcccctgaagaggcgccctccgctgaggcgcccgcaccggctgaagcccccgccgcg
gaggctgcccccgcagcttccggcgaaagccatgaagtcacccttccggctctcggcgaa
tcagtcaccgaaggcaccgtaacccgctggcttaaggccgtcggcgactccgtcgaggtt
gacgagcccctgctcgaggtatccaccgacaaggtggacaccgagatcccgtccccggtg
gctggcaccctgcaggaaatccgcgtcaacgaggacgaaaccgccgaggttggctccgtt
ctggccgttatcggctccggcgctgctgcaccggccgcccctccggcggctccggccccc
cagcaggaagcccccgctgccgaagctccgaagcaggaagcccccgccgcagctcccgcg
gccccggctgccgctcccgccaaggaagaagcaccggctcccaagcaggaagccccggct
gcaccggctgcagaatccgcggccccggccgagtccggctacgtcactcccctggtgcgc
aagctcgccaaccagcagggcgtggacatctcctcgctgaccggcaccggagtgggcgga
cgcatccgcaagcaggacgtgcttgcagccgccgaggccaaggctgctccggccgccgca
gcgccggccgcttccacgcagggtgcccccgcgtctgctccgacggccgccgaatcctca
ctgcgcggcaccgtgcagaaggcaccgcgtatccgtcaggtcattgcccgccgcatgcgt
gagtccctggacatctccacccagctgacgcaggtccacgaagtggacatgactaagatt
gccaagctgcgcctcaaggccaagaactcgttccaggcacagaacggcgtgaagctcacc
ttcctgccgttcatcgccaaggcagtcgcggaggccctgaagcagcacccgaaggtgaat
gctgcctacgacgaggacaagcaggaaatcacctaccacaacgccgagcacctggccatc
gccgtggacaccgacaagggcctccttgttccggtcatctccgacgccggcagcctgaac
ctcgccggcctggccggcaagatcgcagacgtggcaggccgtacccgcgatggcaagatc
ggcccggatgaactgtccggcggcacgttcagcatcaccaacatcggttccgttggcgca
ctgttcgacacgccgatcatcaaccagccgcaggtcggcatcctcggcacgggtgcgatc
gtcaagcgtcccgtggtggtcactgacgaaaacggcgacgactcgatcgccatccgctcc
atgatgtacctctccctgacgtacgaccaccgcctggtggacggcgccgacgcaggacgc
ttcctgcagaccctcaaggcccgcctcgaggccggcgccttcgaggcggacctggggctg
tag

DBGET integrated database retrieval system