KEGG   Arthrobacter sp. FB24: Arth_1688Help
Entry
Arth_1688         CDS       T00421                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arth_1688
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arth_1688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arth_1688
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arth_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1879993..1881324
Genome map
AA seq 443 aa AA seqDB search
MVDAPTTGSDEGTADAFLQGDRSLRHAPGPYFGSYGGRWMPESLIAALDELEDTFEKAKA
DPEFVAQIKDLNKNYSGRPSLLTEAKRFAEHAGGVRIFLKREDLNHTGSHKINNVLGQAL
LAKRMGKTRVIAETGAGQHGVASATAAALLGLECVVYMGAEDCRRQALNVARMELLGATV
IPVTSGSQTLKDAINEALRDWVANVDHTHYLLGTAAGAHPFPAMVRYFHEVIGEEARAQI
LEQAGRLPDAVCACIGGGSNAIGIFHGFLDDPSVRIYGFEAGGDGVETGRHAATISLGKP
GVLHGARSYLMQDDDGQTIESHSISAGLDYPGVGPEHAYLSDIGRVSYEPITDAEAMDAF
RVLCRTEGIIPAIESAHALAGAIKVGQRLAAEAAAEGQPADSKIVIVNLSGRGDKDVATA
AEWFDLLDKDSVEAEIGKEGEQL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgcgccaacaaccggctctgatgagggcaccgcggacgcatttctgcaagga
gaccggtccctgcgccacgcgccgggtccgtacttcggctcctacggcgggcgctggatg
cccgaatcccttatcgcggccctggatgagctggaagacactttcgaaaaggccaaggcc
gacccggaattcgtcgcccagatcaaggacctgaacaagaactactccggccgtccgtcc
ctgctgaccgaggccaagcgcttcgcggagcacgccgggggagtccgcatcttcctcaaa
cgcgaggacctgaaccacaccggttcgcacaagatcaacaacgtcctgggccaggccctg
ctggccaagcgcatgggcaagacccgcgtgatcgccgagaccggtgcgggccagcacggc
gtagccagcgcaacggccgccgccctgctgggcctcgagtgtgtggtgtacatgggcgcc
gaggactgccggcgccaggccctgaacgtggcccgcatggagctcctgggcgccacggtc
attccggtgaccagcggatcgcagacgctcaaggacgccatcaacgaggcgctccgcgac
tgggtggcgaacgtggaccacacccactacctgctcggcacggccgccggtgcccacccg
ttcccggcgatggtgcggtacttccacgaggtcatcggtgaagaagcccgcgcccagatc
ctggaacaggccggcaggctgccggacgccgtctgtgcctgcatcggcggcggctccaac
gcgatcggcatcttccatggcttcctggacgatccttccgtgcggatttacggcttcgag
gccggcggcgacggcgtggaaaccggccggcacgccgccaccatcagcctgggcaagccg
ggtgtgctccacggtgcgcgctcgtacctgatgcaggacgacgacgggcagaccatcgag
tcgcactccatctccgcgggcctggactatcccggcgtcggcccggagcatgcctacctt
tcggacatcggccgcgtcagctacgaacccatcacggatgccgaagccatggatgccttc
cgggtcctgtgccggaccgagggcatcattccggccatcgaatcggcacatgccctggcg
ggagccatcaaggtggggcagcgcctcgccgccgaagctgcagccgaaggccagcccgcg
gacagcaagatcgtgatcgttaacctctccggccgcggggacaaggacgtggccacggcc
gccgaatggttcgacctgctggacaaggattccgttgaggccgagatcggcaaagaaggg
gaacagctgtga

DBGET integrated database retrieval system