KEGG   Arthrobacter sp. FB24: Arth_1688Help
Entry
Arth_1688         CDS       T00421                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arth_1688
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arth_1688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arth_1688
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arth_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1879993..1881324
Genome map
AA seq 443 aa AA seqDB search
MVDAPTTGSDEGTADAFLQGDRSLRHAPGPYFGSYGGRWMPESLIAALDELEDTFEKAKA
DPEFVAQIKDLNKNYSGRPSLLTEAKRFAEHAGGVRIFLKREDLNHTGSHKINNVLGQAL
LAKRMGKTRVIAETGAGQHGVASATAAALLGLECVVYMGAEDCRRQALNVARMELLGATV
IPVTSGSQTLKDAINEALRDWVANVDHTHYLLGTAAGAHPFPAMVRYFHEVIGEEARAQI
LEQAGRLPDAVCACIGGGSNAIGIFHGFLDDPSVRIYGFEAGGDGVETGRHAATISLGKP
GVLHGARSYLMQDDDGQTIESHSISAGLDYPGVGPEHAYLSDIGRVSYEPITDAEAMDAF
RVLCRTEGIIPAIESAHALAGAIKVGQRLAAEAAAEGQPADSKIVIVNLSGRGDKDVATA
AEWFDLLDKDSVEAEIGKEGEQL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgcgccaacaaccggctctgatgagggcaccgcggacgcatttctgcaagga
gaccggtccctgcgccacgcgccgggtccgtacttcggctcctacggcgggcgctggatg
cccgaatcccttatcgcggccctggatgagctggaagacactttcgaaaaggccaaggcc
gacccggaattcgtcgcccagatcaaggacctgaacaagaactactccggccgtccgtcc
ctgctgaccgaggccaagcgcttcgcggagcacgccgggggagtccgcatcttcctcaaa
cgcgaggacctgaaccacaccggttcgcacaagatcaacaacgtcctgggccaggccctg
ctggccaagcgcatgggcaagacccgcgtgatcgccgagaccggtgcgggccagcacggc
gtagccagcgcaacggccgccgccctgctgggcctcgagtgtgtggtgtacatgggcgcc
gaggactgccggcgccaggccctgaacgtggcccgcatggagctcctgggcgccacggtc
attccggtgaccagcggatcgcagacgctcaaggacgccatcaacgaggcgctccgcgac
tgggtggcgaacgtggaccacacccactacctgctcggcacggccgccggtgcccacccg
ttcccggcgatggtgcggtacttccacgaggtcatcggtgaagaagcccgcgcccagatc
ctggaacaggccggcaggctgccggacgccgtctgtgcctgcatcggcggcggctccaac
gcgatcggcatcttccatggcttcctggacgatccttccgtgcggatttacggcttcgag
gccggcggcgacggcgtggaaaccggccggcacgccgccaccatcagcctgggcaagccg
ggtgtgctccacggtgcgcgctcgtacctgatgcaggacgacgacgggcagaccatcgag
tcgcactccatctccgcgggcctggactatcccggcgtcggcccggagcatgcctacctt
tcggacatcggccgcgtcagctacgaacccatcacggatgccgaagccatggatgccttc
cgggtcctgtgccggaccgagggcatcattccggccatcgaatcggcacatgccctggcg
ggagccatcaaggtggggcagcgcctcgccgccgaagctgcagccgaaggccagcccgcg
gacagcaagatcgtgatcgttaacctctccggccgcggggacaaggacgtggccacggcc
gccgaatggttcgacctgctggacaaggattccgttgaggccgagatcggcaaagaaggg
gaacagctgtga

DBGET integrated database retrieval system