KEGG   Arthrobacter sp. FB24: Arth_1688Help
Entry
Arth_1688         CDS       T00421                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:art01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:art00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:art00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1879993..1881324
Genome map
AA seq 443 aa AA seqDB search
MVDAPTTGSDEGTADAFLQGDRSLRHAPGPYFGSYGGRWMPESLIAALDELEDTFEKAKA
DPEFVAQIKDLNKNYSGRPSLLTEAKRFAEHAGGVRIFLKREDLNHTGSHKINNVLGQAL
LAKRMGKTRVIAETGAGQHGVASATAAALLGLECVVYMGAEDCRRQALNVARMELLGATV
IPVTSGSQTLKDAINEALRDWVANVDHTHYLLGTAAGAHPFPAMVRYFHEVIGEEARAQI
LEQAGRLPDAVCACIGGGSNAIGIFHGFLDDPSVRIYGFEAGGDGVETGRHAATISLGKP
GVLHGARSYLMQDDDGQTIESHSISAGLDYPGVGPEHAYLSDIGRVSYEPITDAEAMDAF
RVLCRTEGIIPAIESAHALAGAIKVGQRLAAEAAAEGQPADSKIVIVNLSGRGDKDVATA
AEWFDLLDKDSVEAEIGKEGEQL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgcgccaacaaccggctctgatgagggcaccgcggacgcatttctgcaagga
gaccggtccctgcgccacgcgccgggtccgtacttcggctcctacggcgggcgctggatg
cccgaatcccttatcgcggccctggatgagctggaagacactttcgaaaaggccaaggcc
gacccggaattcgtcgcccagatcaaggacctgaacaagaactactccggccgtccgtcc
ctgctgaccgaggccaagcgcttcgcggagcacgccgggggagtccgcatcttcctcaaa
cgcgaggacctgaaccacaccggttcgcacaagatcaacaacgtcctgggccaggccctg
ctggccaagcgcatgggcaagacccgcgtgatcgccgagaccggtgcgggccagcacggc
gtagccagcgcaacggccgccgccctgctgggcctcgagtgtgtggtgtacatgggcgcc
gaggactgccggcgccaggccctgaacgtggcccgcatggagctcctgggcgccacggtc
attccggtgaccagcggatcgcagacgctcaaggacgccatcaacgaggcgctccgcgac
tgggtggcgaacgtggaccacacccactacctgctcggcacggccgccggtgcccacccg
ttcccggcgatggtgcggtacttccacgaggtcatcggtgaagaagcccgcgcccagatc
ctggaacaggccggcaggctgccggacgccgtctgtgcctgcatcggcggcggctccaac
gcgatcggcatcttccatggcttcctggacgatccttccgtgcggatttacggcttcgag
gccggcggcgacggcgtggaaaccggccggcacgccgccaccatcagcctgggcaagccg
ggtgtgctccacggtgcgcgctcgtacctgatgcaggacgacgacgggcagaccatcgag
tcgcactccatctccgcgggcctggactatcccggcgtcggcccggagcatgcctacctt
tcggacatcggccgcgtcagctacgaacccatcacggatgccgaagccatggatgccttc
cgggtcctgtgccggaccgagggcatcattccggccatcgaatcggcacatgccctggcg
ggagccatcaaggtggggcagcgcctcgccgccgaagctgcagccgaaggccagcccgcg
gacagcaagatcgtgatcgttaacctctccggccgcggggacaaggacgtggccacggcc
gccgaatggttcgacctgctggacaaggattccgttgaggccgagatcggcaaagaaggg
gaacagctgtga

DBGET integrated database retrieval system