KEGG   Arthrobacter sp. FB24: Arth_1689Help
Entry
Arth_1689         CDS       T00421                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arth_1689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arth_1689
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arth_1689
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arth_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1881321..1882139
Genome map
AA seq 272 aa AA seqDB search
MTGVQDITSTSKSAAAIDKARAEGRVALIGYLPAGFPSVEDTIAVGIALAENGADLIEIG
IPYSDPVMDGQVIQAATTEALAKGFHVRQVFDVVRGITSKTDAAVLVMTYWNPVVRMGVD
EFSRQLAEAGGAGLITPDLIPDEASEWMAASDKYGLDRVFLVAPSSSPERMKRTVDASRG
FVYAVSIMGVTGARTSVSSAAEGVVAAAHAAGAERVCVGLGVSNAGQVREIAAYADGVIV
GTALVAAIRDGGVDAVAALTKDLSTGLTREEA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgttcaggacatcaccagcaccagcaaatcggcagccgccatcgacaaggca
cgcgctgaagggcgggtcgccctcatcgggtacctgcccgccggcttccccagcgtggag
gacaccatcgccgtcggcatcgcgctggccgagaacggtgccgacctgatcgagatcggg
atcccgtactccgatcccgtcatggacgggcaggtcatccaggctgccaccacggaggcc
ctcgccaagggcttccacgtccgccaggtcttcgacgtggtccgcggcatcaccagcaag
accgacgccgccgtcctggtgatgacctactggaaccccgtagtccggatgggcgtggac
gagttctcccgccagctggccgaagccgggggagccgggctcatcacccccgacctgatt
ccggacgaagcctccgaatggatggctgcctcggacaagtacggactggaccgtgtgttc
cttgtcgccccgtcctcttccccggagcgtatgaagcgcacggtggatgccagccgcggc
ttcgtctacgcagtgtccatcatgggcgtcaccggtgcccggacttccgtcagcagcgct
gcggaaggcgtcgttgccgccgcgcatgctgcaggagccgaacgcgtatgcgtgggcctc
ggagtctccaatgccggccaggtccgcgagatcgcggcctatgcagacggcgtaatcgtg
ggcaccgcattggtcgccgccatccgtgacggcggcgtggacgctgtcgccgccctgacc
aaagacctcagcaccggcctgaccagggaagaagcctaa

DBGET integrated database retrieval system