KEGG   Arthrobacter sp. FB24: Arth_1710Help
Entry
Arth_1710         CDS       T00421                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00052  Galactose metabolism
art00500  Starch and sucrose metabolism
art00520  Amino sugar and nucleotide sugar metabolism
art00521  Streptomycin biosynthesis
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
art_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_1710
   00052 Galactose metabolism
    Arth_1710
   00500 Starch and sucrose metabolism
    Arth_1710
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_1710
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arth_1710
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Arth_1710
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arth_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABK03104
JGI: Arth1710
UniProt: A0JVN4
Position
1910878..1911840
Genome map
AA seq 320 aa AA seqDB search
MHTTGGPAPNAERAPVLAFDVGGTDLKSGIVRPDGQIIGLRRTRTPLSASAPGDAIVEVI
GSLTRSYRHAYPSLAITAIGLSVPGIVDERTGTGVISSNLGWRDYPFVQRTETALGIPVA
FGHDVGAAGDAEFRLGRARDSTNGMFLAIGTGIAGVIYADGMRIHGEGVAGEVGQVPVPD
PDHPRGTTILENVASAGAIVKRYNAATHRQVAGAKDVLNAAAAGDPAAQNVWSQAVESLA
FSLAHCVALLGSRTVIIGGGLSQAGDALFDPLAREITKHLTVHTAPAIVPASLGENAGLI
GSALNTFDLLDAKEAARHDL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgcacacgacaggggggccggcgccaaacgcggaacgagcgccggtcctcgccttcgac
gtgggcggaaccgaccttaaatcaggaattgtccgccccgacggacaaataatcggccta
cgccggaccaggacgccgctgtctgcctccgccccgggcgacgccatagtggaagtcatc
ggatccttgacccgctcctatcggcacgcctacccttccctggccatcaccgccataggc
ctctccgtgccgggaatcgtcgacgaacggaccgggacaggggtcatctcctccaacctc
ggctggcgcgactaccctttcgtccagaggactgaaaccgcactcggaataccagtggct
ttcggccatgacgtcggggccgccggggacgcagaattccggctggggcgggccagggac
tcaaccaacgggatgttcctggccataggcaccggtatcgccggagtcatctatgccgac
ggaatgcgcatccacggagaaggagtggcgggggaagtgggccaagtccccgtgcccgac
cctgaccacccacggggcacgacaattctggaaaacgtggcttcagccggggcgattgtc
aagcgctacaacgccgccacacaccggcaggttgcaggcgccaaggacgtcctgaacgcg
gccgccgccggtgacccggcagctcagaacgtctggagccaggccgtggagtcgctggca
ttcagtcttgcgcattgcgtggcacttctcgggtccaggacagtcatcatcggcggcggc
ctgtcacaagccggagacgccctgttcgaccctctggccagagagataacgaaacacctc
accgtccacacagcaccggcaatcgtgcccgccagcctgggcgaaaacgccggcctgatc
ggctccgcactcaacacattcgaccttctcgacgcaaaggaggccgcccgccatgacctc
tga

DBGET integrated database retrieval system