KEGG   Arthrobacter sp. FB24: Arth_1710Help
Entry
Arth_1710         CDS       T00421                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_1710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_1710
   00052 Galactose metabolism
    Arth_1710
   00500 Starch and sucrose metabolism
    Arth_1710
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_1710
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arth_1710
   00524 Butirosin and neomycin biosynthesis
    Arth_1710
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arth_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1910878..1911840
Genome map
AA seq 320 aa AA seqDB search
MHTTGGPAPNAERAPVLAFDVGGTDLKSGIVRPDGQIIGLRRTRTPLSASAPGDAIVEVI
GSLTRSYRHAYPSLAITAIGLSVPGIVDERTGTGVISSNLGWRDYPFVQRTETALGIPVA
FGHDVGAAGDAEFRLGRARDSTNGMFLAIGTGIAGVIYADGMRIHGEGVAGEVGQVPVPD
PDHPRGTTILENVASAGAIVKRYNAATHRQVAGAKDVLNAAAAGDPAAQNVWSQAVESLA
FSLAHCVALLGSRTVIIGGGLSQAGDALFDPLAREITKHLTVHTAPAIVPASLGENAGLI
GSALNTFDLLDAKEAARHDL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgcacacgacaggggggccggcgccaaacgcggaacgagcgccggtcctcgccttcgac
gtgggcggaaccgaccttaaatcaggaattgtccgccccgacggacaaataatcggccta
cgccggaccaggacgccgctgtctgcctccgccccgggcgacgccatagtggaagtcatc
ggatccttgacccgctcctatcggcacgcctacccttccctggccatcaccgccataggc
ctctccgtgccgggaatcgtcgacgaacggaccgggacaggggtcatctcctccaacctc
ggctggcgcgactaccctttcgtccagaggactgaaaccgcactcggaataccagtggct
ttcggccatgacgtcggggccgccggggacgcagaattccggctggggcgggccagggac
tcaaccaacgggatgttcctggccataggcaccggtatcgccggagtcatctatgccgac
ggaatgcgcatccacggagaaggagtggcgggggaagtgggccaagtccccgtgcccgac
cctgaccacccacggggcacgacaattctggaaaacgtggcttcagccggggcgattgtc
aagcgctacaacgccgccacacaccggcaggttgcaggcgccaaggacgtcctgaacgcg
gccgccgccggtgacccggcagctcagaacgtctggagccaggccgtggagtcgctggca
ttcagtcttgcgcattgcgtggcacttctcgggtccaggacagtcatcatcggcggcggc
ctgtcacaagccggagacgccctgttcgaccctctggccagagagataacgaaacacctc
accgtccacacagcaccggcaatcgtgcccgccagcctgggcgaaaacgccggcctgatc
ggctccgcactcaacacattcgaccttctcgacgcaaaggaggccgcccgccatgacctc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system