KEGG   Arthrobacter sp. FB24: Arth_1803Help
Entry
Arth_1803         CDS       T00421                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:art00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2017437..2018966)
Genome map
AA seq 509 aa AA seqDB search
MTTKYIMALDAGTTGIRAIIYDSKVEIVGEASQEFTQIYPKPGWVEHDPMEIWNTQLAVA
RRALQGAGIDPHDIGAVGVTNQRETTVVWDRDTGKPIMNAIVWQDRRTAGVCDGLKEKGL
EEHVRSTTGLVIDAYFSGTKIAWILDNVPGARARAEAGELCFGTIDSWIIWNLTAGAAHV
TDYSNAARTMLFDINTLDWDDKLLGELGVPRLMLPDVRPSSEVYGHTCDGIFAGAHIPVA
SAIGDQQAALFGQACFDRGMVKATYGTGASLVMNTGDKPVSSANGMLTTIAWGINGEVEY
ALEGLIFVAAASIQWLRDELRVIYDSADSEYAAMRVEDSGGVYVVPAFTGLAAPYWDPYA
RGAILGLTRGSSRNHIIRATLESIAFQIKDVIDCMEADAGLPVSEIRVDGGAVRNNFLMQ
FQADMVNVPVLRPRQVESTARGAALLAGLACGFWASKDELRDTFALDRAFTPDMSEEKRS
ALYAGWQKAVTRACNWEEHEPATPSTTNP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaagtacatcatggcgctggatgccgggacaaccggtatccgggcaatcatc
tatgactcaaaggtagagatcgtaggcgaagcgagccaggagttcacccagatctacccc
aagccggggtgggtggaacacgatcccatggagatctggaatacacaactggccgtggca
cggcgtgcccttcagggagccgggatcgatccgcacgacatcggtgcggtcggcgtcacg
aaccagcgtgaaaccacagtcgtctgggacagggacacgggcaagcccatcatgaacgcc
atcgtgtggcaggacaggcgcacggccggagtatgcgacggcctcaaagagaagggtctg
gaggagcatgtccggtccacgaccgggctggtcatcgacgcctacttctccggcaccaaa
atcgcgtggatcctggacaacgtccccggtgcacgggcccgtgcggaggccggcgagctg
tgcttcggcaccatcgacagctggatcatttggaacctgactgccggggccgcgcatgtc
accgattactccaatgcggcgaggacgatgctcttcgacatcaacaccctggactgggac
gacaaactcctcggggagctgggcgtaccgcgtctaatgctccccgacgtccggccaagc
agcgaagtctacggacacacctgcgacggaatctttgcgggcgcccatatcccggtcgcc
tcggcaatcggagaccagcaggcggctctgttcgggcaggcgtgcttcgaccgcggcatg
gtcaaggcgacttacggcaccggcgccagtctggtcatgaataccggcgacaaaccagtc
agctcggcgaacggaatgctgaccaccattgcctggggaatcaacggcgaagttgaatat
gcgcttgaaggactgattttcgtggccgcggcgtccatccaatggctacgggatgagctc
cgggtcatctatgattcggccgacagtgagtacgccgcaatgcgggtggaggattccggc
ggggtatacgttgttcccgcgttcaccggcctggccgcgccgtactgggacccgtatgcc
cgcggcgcgatcctcggactcacccgtggctcgagccgcaaccacatcatccgggccacg
ctcgaatccattgcgttccagatcaaggacgtcatcgattgcatggaggccgatgccgga
ctccccgtctccgaaatccgtgtcgacggcggtgcggtgcggaacaacttcctcatgcag
ttccaggccgacatggtcaacgtcccggtcctccgtccccggcaagtcgaatccacggca
cgcggagccgcgcttctggcgggccttgcctgtgggttctgggcgagcaaagacgaactg
cgtgacacattcgcacttgaccgggccttcaccccggacatgtctgaagaaaaacgctct
gccctgtacgccgggtggcaaaaggccgtcacccgcgcctgcaactgggaagagcacgaa
cccgccaccccatctaccaccaatccctag

DBGET integrated database retrieval system