KEGG   Arthrobacter sp. FB24: Arth_1809Help
Entry
Arth_1809         CDS       T00421                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
art  Arthrobacter sp. FB24
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_1809
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Arth_1809
Enzymes [BR:art01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Arth_1809
Peptidases [BR:art01002]
 Cysteine Peptidases
  Family C44
   Arth_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023891..2025786
Genome map
AA seq 631 aa AA seqDB search
MCGIVGYVGSVNQDQGNIENRALNVVLGGLSRLEYRGYDSAGVAVLADRGISSRKKAGKL
ANLENLLRSNPLPPAQVAIGHTRWATHGAPTDANAHPHLADDGRLAVIHNGIIENSGPLR
GRLTARGHVFLSETDTEVAAALLAHVYLTLGGDQAGGDALAAAMRRTCAELEGSFTLLAV
HSNHPGLIVAARRNSPLVVGRGERENFLGSDVSAFIDSTRRAIELGQDQVVSLTADEVTI
TDFHGKRAAGKEFVVDWDASSATKDGHSSFMAKEIQEQPEAVRRTLRERIGADGTLSLGQ
LGISDAALAGVRKIIVVACGTASYAGQIAKYAIERWSRIPVEVDFAHEFRYRCPMLDDRT
LVIAISQSGETMDTLMAVRYALEQGAKVLAICNTVGATIPRESDGVLYTHAGPEVAVAST
KAFLTQVTAALLLALYLAQLRGTGDPLEISGAILELGGMPEKIQRALAAEEQIAALAESL
ADATAVLFIGRHVGHPVAMEGALKLKELAYIHAEGFAAGELKHGPIALIEPGQPVVVIVP
SPVSSRTLHAKMMSTIQEIKARGGRVIGVCEEGDAVTGAWADVVVAVPASNPLLAPLLTT
IPLQIFAARLANAKGLDIDQPRNLAKSVTVE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgtgggatatgtcggaagcgtcaaccaagaccagggcaatatcgaaaat
cgtgccctgaacgtcgtcctcggtggcttgagccgccttgaatacagggggtacgactcg
gcgggcgtggccgtgctcgctgaccgcgggatcagctcccgaaagaaagctggaaagtta
gcgaatcttgaaaaccttctccgctccaacccgctgccccccgcgcaggtagccataggc
catacgcggtgggccacgcacggggcgccgacggacgcgaacgcccatccgcaccttgct
gatgatggccgattggctgtcattcataacgggatcatcgaaaattccggcccgttgcgg
ggccgcttgacggcccgtggccacgtgtttctctcggagaccgacaccgaagtcgcagct
gcgctactggctcatgtctacctcaccctgggtggagatcaggctggcggtgatgctctg
gcggcagccatgcgccgtacctgcgcggagctggaggggtccttcacgcttcttgcggta
catagcaaccatcccggactcatcgtcgcggcgcggaggaattccccgctcgtggttggc
cggggtgaacgcgaaaattttctcggatcggatgtgtcggcattcatagactcaacccgc
cgcgccattgagctcgggcaggatcaggttgtcagcctcacggctgacgaagtgaccatc
actgatttccacggcaaacgcgctgccggtaaggaattcgtcgtcgactgggacgccagc
tcggccacgaaggatggccattcctcgttcatggcgaaggagatccaagagcagccagaa
gcggtccgccgcactctccgggagaggataggagcagacgggaccctgtctctgggccag
cttggaatcagcgacgcagctctggccggcgtccggaagatcatcgtcgtggcctgcggt
acggcctcctatgccgggcagattgcgaaatacgccatagagcgctggtccaggattccg
gttgaagtcgactttgcccacgagttccgttaccgctgtccgatgcttgatgacaggacg
ctggtgatagccatatcgcagtccggcgagacgatggacacgctgatggccgtgcggtac
gcccttgaacaaggagccaaggtgctcgccatctgcaacaccgtgggagcgactattccg
cgtgaatccgacggtgtgttgtacacgcatgcaggtcctgaggtggccgtggcctccact
aaggcgttccttacccaggtgacagccgcgctcctgctcgctctctaccttgcccagttg
cgggggaccggggacccgctggaaatttccggggcaatcctcgaactaggaggcatgccg
gaaaagatccaacgggcactggcggcggaggaacagatcgccgcgctcgccgaatcgcta
gccgatgcgacggcggtactcttcatcggtaggcatgtcgggcacccagtggccatggag
ggggccctgaagctgaaggagctggcgtacattcacgccgaaggctttgcagccggcgag
cttaagcatggtccgattgccctcatcgagcccggacagccggtcgtcgtcattgtgccc
tcacccgtgagtagccggacgcttcacgcgaagatgatgtcgacgatccaggagatcaag
gcgcgcggcggtcgcgtcatcggcgtctgtgaagaaggggacgcagtgacgggggcctgg
gcggatgtggtggtggccgtgccggcatcaaatccgcttctggcgccactactaactacc
atcccgctgcaaatttttgctgccaggctggcgaacgcgaaggggctggacattgaccag
cctcggaacctcgccaagtcagtcaccgtagaatag

DBGET integrated database retrieval system