KEGG   Arthrobacter sp. FB24: Arth_1986Help
Entry
Arth_1986         CDS       T00421                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arth_1986
Enzymes [BR:art01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Arth_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2239510..2240919
Genome map
AA seq 469 aa AA seqDB search
MEVYGRGVSDRPDIFTVGELRAAGHVLKDLRQEIRGNLLTALAAGRDPWPGMYGFSRTVL
PQLERALIAGHDVVLLGERGQGKTRLLRTLVGLLDEWSPVIEGSELNEHPFEPITEHSRA
RVLTEGDRLRVSWRHRSERYVEKLATPDTSVADLIGDVDPMRVAEGRRLGDPETIHYGLV
PRSNRGIIAINELPDLAERIQVAMLNVMEERDIQIRGYVLRLPLDVLVVASANPEDYTNR
GRIITPLKDRFGAEIRTHYPIELEDEVSVIRQEGRLVADVPPVILEILARYTRALRQSPA
INQTSGVSARFAIAGAETVAAAALRRASVRGEDEAVARIIDLETAVEVLTGKIEFESGEE
GHEQAVLDHLLRTATAEAVRAHYHGIDLGPLVAALDGHRTVTTGEQVTAREFLENLPSLN
SSGLYDEISGRLGARNDGQRAAAIELALEGLYLARRISKESDDEETVYG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtctacggtagaggagtgagcgatcgtcccgatatcttcaccgttggtgaactg
cgtgcagcaggccatgtcctcaaggatctgcgtcaggagatccgcggcaacctgctcacc
gcgcttgccgccggccgtgatccgtggcccgggatgtacggtttcagccggactgttctt
ccccagctcgagcgtgcgctgatcgccggccacgatgtcgtcctgctcggtgagcgtggt
cagggcaagacacggctgctccgcaccctggtgggtctgctcgacgagtggtccccggtg
atcgaaggttccgaactgaacgaacaccccttcgagccgatcacggagcactcccgtgcc
cgtgtgctgaccgagggggaccggttgcgcgtgtcgtggcggcaccgctcggaacggtac
gtcgagaagctggctacgcctgacacctccgtggccgacctcatcggcgacgtcgacccg
atgcgggtggctgaaggccgtcgactcggggacccggaaaccatccactacggactcgtc
ccgcgctccaaccgcggcatcatcgccatcaacgaactgcccgacctcgccgagcggata
caggtcgcgatgctcaacgtgatggaggagcgcgacatccagatccgcggctatgtgctg
cggttgcccctcgacgtgctcgtcgtcgcgtccgccaacccggaggactataccaaccgc
ggccggatcatcacgcccctgaaggatcgcttcggcgccgagatccggacccactacccg
atagagctggaggacgaggtgtctgtcatccggcaggaggggcggcttgtggctgacgtc
ccgcccgtcatccttgagatcctggcgcgttacacccgggcgctgcggcagtccccggct
atcaaccagacttccggagtctcggcgcggttcgccatcgcgggcgcggaaaccgttgcc
gctgcggcgctgcgccgtgccagcgtgcgcggcgaggacgaggccgtcgcccgcatcatt
gacctggagactgcagtggaagtcctcacaggcaagatcgagtttgaatccggtgaggaa
gggcatgaacaggcggtcctcgaccacctcctgcgcacggccacggccgaagctgtgcgg
gcgcactaccacggaatcgacctcggtccgctggtggcggccctcgacggccacaggaca
gtgaccaccggagagcaggtcactgcacgggagttcctggaaaacctcccgtcccttaac
tcatccggcctctatgacgagatcagcgggcgcctgggcgccaggaatgacggacagcgt
gccgccgcaatcgaacttgcattggaaggcctttacctcgcccggcggatctccaaggag
tccgacgacgaggagacggtctacggctag

DBGET integrated database retrieval system