KEGG   Arthrobacter sp. FB24: Arth_2153Help
Entry
Arth_2153         CDS       T00421                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
art  Arthrobacter sp. FB24
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arth_2153
Enzymes [BR:art01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Arth_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2425857..2428010
Genome map
AA seq 717 aa AA seqDB search
MADGTEQDHTGTTDELLRKLAAVRGVSTSFRGWDGKEHPVAASTLHSVLAALGDRTGTPD
ELQDALREAELAPWRRLLPPSVVSREGREIHVAVHVPHGTPVRVWAVTEDGNRVEAGQRD
NWEDPRDVDGTLTGRASFAIPGDLPLGWHTLHADAAGELAECALVITPERLETTRRLASE
RHWGLTAQLYSVRSSRSWGIGDFSDLLDLAAIAGEDGAGFVLVNPLHAGEPRPPIEDSPY
LPTTRRFFNPLYIRVEDVPEYGYLDPASRAGIEKNAALLHSANTAVGLLERNVSYQAKLE
ALELIFKVRRSPGRARMFENFCAAEGKGIDDFALWCTLAERLPPTAPEWSGEALSPDTPY
CDNVRHEQADRLEFYRWLQWICDEQLATAQRTAKHCGMAIGIVHDLAVGVKTTGADAWML
RGVLAQGVTVGAPPDVFNQQGQNWTQPPWHPGRLAAAGYKPYRDMLRTVLRHAGGIRVDH
ILGLFRLWWIPEFAGPDEGTYVYYDHEALIGILALEAQRAGATVVGEDLGVFEPWVRDYL
TERGILGTSILWFEHNEAGPLPPEKYRQQCLTSVNTHDLPPTAGYLAGEHVTLRETLGLL
LRPVEEERAEAAAEQEAVLALVRERGLLADSSADVQRTVEALYALTALTPSALLGVALVD
AVGETRTQNQPGTDAEHPNWRIPLAGPGGPVLIDDLADNARFNSLVGVVRDALKPSG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcggatggaacggaacaggaccacacaggaacaacagacgaactgctccgcaagctg
gcggcagtacgcggcgtaagcacgtctttccgcggctgggacggtaaggaacatcccgtc
gcggcaagcacgctgcacagcgtgcttgccgcgctgggagaccggaccgggacgccggac
gagctccaagacgcccttcgcgaggcggaactggcgccgtggcggaggctgctgccgcca
tcggtggtatcgagagaaggtcgcgaaatccacgttgccgtccatgtcccgcacggaaca
cccgtcagggtgtgggcggtaaccgaggacgggaaccgcgttgaggccggccagcgcgac
aactgggaggatccgcgggacgtggacggcacgctcacagggcgggcgtcctttgccatt
cccggcgatctgccccttggctggcacaccctgcatgccgatgccgccggggaactcgcg
gaatgtgccctggtcattacgcccgagcggctggaaaccaccaggcgcctggcatccgag
cgccattgggggctcacagcccagctgtactcggtccggtcttcccgctcttggggcatc
ggcgatttctccgaccttctggaccttgccgcgattgcaggagaggacggtgcgggtttt
gtcctggtaaatcccctgcacgcgggggaaccccggcctcccattgaggattcgccgtat
ctgcccaccacccgccgtttcttcaacccgctctatatccgcgttgaggacgtgccggag
tacggatacctggaccctgcatccagggcaggcatcgagaagaacgcggcattgcttcat
tccgccaatacggcggtcggcctgctggaaagaaacgtcagctaccaagccaaactcgag
gcccttgagctcattttcaaggtccgccgcagtcccggccgtgcgcgcatgtttgagaac
ttctgcgcagcggaaggcaagggcatcgatgacttcgccctgtggtgcacgcttgcggag
cggcttccgccgacggcgcccgagtggtccggcgaggcactgtccccggacaccccgtac
tgcgacaatgtgcggcacgagcaagcggaccggctggagttttaccgctggttgcagtgg
atctgcgacgagcagctggctaccgcccagcggacggcgaaacattgcgggatggccatc
ggcatcgtccatgacctggcggtgggcgtcaagaccaccggggcagacgcctggatgctt
cgcggcgtgctcgcccagggcgtcactgtcggcgccccgccggacgtcttcaaccagcag
ggacagaactggacccagccgccttggcaccccggacggctggcggcggcagggtacaaa
ccgtaccgcgacatgctgcgaaccgtactccgccatgcaggcggcatccgcgtggaccac
atccttggactcttccgcctgtggtggatcccggaattcgccggtccggacgagggcacg
tatgtgtactacgaccatgaagccctcatcggcatcctggcacttgaggcccagcgggcc
ggcgcgactgttgtcggcgaggaccttggcgtgttcgaaccctgggtccgtgactacctc
acggagcggggcatcctcggcacttccatcctgtggttcgaacacaatgaagcgggcccg
ctgccgcccgaaaagtaccgccaacagtgcctgaccagcgtcaacacccacgacctgccc
ccgacggccggatacctcgcgggggagcatgtcacgctccgcgaaacgctgggcctgctc
ctgcgcccggtcgaagaggaacgggcggaggcggcagcggagcaggaggccgtgctggcc
ctggtccgcgaacgggggctgctcgcggattcgtcggcggacgttcagcgcaccgtcgag
gcgctgtacgcattgaccgccttgacgccgtctgccctactgggcgttgccctggtcgac
gccgtcggtgagactcgcacgcagaaccagcccggaacggacgcggagcacccgaattgg
cgtattccgctcgcggggcccggggggccggtactgattgacgacctggcggataacgcc
cggttcaattcgttggtcggggtggtccgggatgcgctgaagccgtccggttaa

DBGET integrated database retrieval system