KEGG   Arthrobacter sp. FB24: Arth_2248Help
Entry
Arth_2248         CDS       T00421                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arth_2248
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Arth_2248
Exosome [BR:art04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arth_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2530665..2532179)
Genome map
AA seq 504 aa AA seqDB search
MNQYVIAIDQGTTSTRAIVFDHSGSIVSSGQMEHEQIFPQAGWVEHDPAEIWNNTREVIA
SALSKANLTRHDIAAVGITNQRETAVVWDKTTGKAIYNAIVWQDTRTQDIVDELAKDGGP
ERFKQKVGLPLATYFSGTKIKWILDNVEGARAKAEAGDLVFGNTDCWVLWNLTGGVDGGV
HVTDVTNASRTMFMDLDTLSWDQEILDAFGVPASMMPAIKSSSEVYGTVHTSQLLREVPV
AGILGDQQAATFGQAAFDAGEAKNTYGTGCFLIFNTGEEIVHSKNGLLTTVGYKLGDAAP
HYALEGSIAVTGSLIQWLRDNLGLISSAPEVETLAASVKDNGGVYIVPAFSGLFAPYWRS
DARGAIVGLTRFVNKNHIARAALEATAFQTREVLDAVNADSGVPLTELKVDGGMVANDAL
MQFQADILGVPVIRPKVVETTALGAAYAAGLAVGFWKDLGECSANWSEDKRWEPQMDDAE
RDRQMRLWKKAVTKSMDWVDEDVK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtacgtaatcgccatcgaccagggcaccaccagcacgcgcgccatcgtcttc
gaccacagcggcagcatcgtctcctccggccagatggaacacgagcagatctttccgcag
gccggctgggtggagcacgaccccgccgaaatctggaacaacacccgcgaggtcattgcc
tcggcgctttccaaagcgaacctgacccggcacgacatcgccgccgtcggcatcaccaac
cagcgcgaaaccgccgtcgtgtgggataagacaacgggcaaggcgatctacaacgccatc
gtctggcaggacacccggacgcaggacatcgtggatgaactggccaaggacggcggaccg
gagcgcttcaaacagaaggtgggcctgccgctggccacgtacttctccggcaccaagatc
aaatggatcctggataacgtggaaggcgcccgtgccaaggccgaagccggtgatctggtc
tttggcaacactgactgctgggtgctgtggaacctcaccggcggagtggatggcggcgtg
cacgtcacggacgtcaccaacgcctcccggaccatgttcatggacctggacacgctgtcc
tgggaccaggagatccttgacgccttcggtgttcccgcgtcaatgatgcccgcaatcaag
tcctcctccgaggtgtacggaaccgtccacacctcgcagttgctccgggaagtgccggtt
gccggcatcctcggcgaccagcaggcagccacgttcggccaggcggcatttgatgccggc
gaagccaagaacacgtacggaacgggctgcttcctgatcttcaacaccggcgaggagatc
gtccattccaagaacggactgctgaccaccgtgggctacaagctgggggatgctgctccg
cactacgccctggaaggctcgatcgccgtcaccggatccctgatccagtggctgcgggac
aacctcggcctgatcagcagtgccccggaggtggagacgctcgcggcctcggtcaaggac
aacggcggcgtctacatcgtgccggcgttctccggcctcttcgcgccgtactggcggtcc
gatgcccgcggcgcgatcgttggcctgacccgcttcgtgaacaagaaccacatcgcccgt
gcggcgctggaggccacggccttccagacccgtgaggtgctcgacgccgtcaacgcggac
tccggtgttccgctgactgagttgaaggtcgacggcggcatggttgccaacgacgccctg
atgcagttccaggcggacatcctgggcgttccggtgatccggccgaaggttgtggaaacc
accgccctcggtgccgcctacgctgccggcctggccgtcggcttctggaaggacctaggg
gagtgctcggccaactggtccgaggacaagcgctgggaaccgcagatggacgacgccgag
cgggaccgccagatgcgcctctggaagaaggccgtcacgaagtccatggactgggtcgac
gaggacgtgaaatag

DBGET integrated database retrieval system