KEGG   Arthrobacter sp. FB24: Arth_2430Help
Entry
Arth_2430         CDS       T00421                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
art  Arthrobacter sp. FB24
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arth_2430
   00051 Fructose and mannose metabolism
    Arth_2430
Enzymes [BR:art01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Arth_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2724998..2726185
Genome map
AA seq 395 aa AA seqDB search
MTLQPTPADRFTFGLWTVGWTGADPFGVATRPALDPVEAVHKLSELGAYGITFHDNDLVP
FDATASERELILKNFKAALAETGLKTPMVTTNLFSHPVFKDGGFTSNDRSVRRFALSKVL
QNIDLAAELGAETFVMWGGREGSEYDGSKDLSAALDRMKEGVDTAAAYIKDKGYGLRIAL
EPKPNEPRGDIFLPTVGHGLAFIAQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAGK
LFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPKYDGPRHFDYKPSRTD
GYDGVWESAKSNMSMYLLLKERALAFRADPDVQEALKTSGVFELGEPTLAAGETTADLLA
DASAFAEFDADAAAQRSFAFVRLNQLAIEHLLGAR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcagcccaccccagcagaccgcttcaccttcggcctttggaccgtcggctgg
accggggcggatcctttcggggtcgccacccgccctgccctggaccccgtcgaggccgtc
cacaagctcagcgaactgggcgcttacggcatcaccttccatgacaatgacctggtcccg
ttcgacgcaacggcttccgagcgcgagctgatcctgaagaacttcaaggccgccctcgcc
gagacgggcctcaagacccccatggtcaccaccaacctgttcagccatcctgtcttcaag
gacggcggctttacctccaatgaccggtccgtccgccggttcgcgctcagcaaggtcctt
cagaacatcgaccttgcagccgagctgggtgcggagaccttcgtcatgtggggcgggcgc
gaaggcagcgagtatgacggttccaaggacctctctgccgcgctggaccggatgaaggaa
ggcgtggacacggccgcggcttacatcaaggacaaggggtacggccttcggatcgccctg
gaaccgaagcccaacgagccccgcggcgacatcttcctgcccaccgtcggccacggactg
gccttcatcgcgcagctggaacacggcgacatcgtgggcctcaacccggaaaccgggcac
gagcagatggccggactgaacttcacccatggcatcgcccaggcgctgtgggccggcaag
ctcttccacatcgacctcaacggccagcgcggcatcaagtacgaccaggacctcgtgttc
gggcacggcgacctcaccagcgcattcttcaccgtggacctgctcgaaaacggcttcccc
aacggcggtccgaagtatgacggcccgcgtcacttcgactacaagccctcacgcaccgac
ggatacgacggcgtctgggaatccgcgaaatccaacatgtccatgtacctcctcctgaag
gagcgcgccctggccttccgcgccgaccccgatgtccaggaagccctgaagacctccggt
gtcttcgaactcggcgagcccacccttgccgccggagagaccacggcggatttgctggct
gacgcttccgcgttcgcggagttcgacgccgatgccgccgcccagcggtcattcgccttc
gtccgcctcaaccagctggccatcgagcacctgctcggcgcccgctag

DBGET integrated database retrieval system