KEGG   Arthrobacter sp. FB24: Arth_2622Help
Entry
Arth_2622         CDS       T00421                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arth_2622
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arth_2622
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arth_2622
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arth_2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2938903..2940009)
Genome map
AA seq 368 aa AA seqDB search
MAHQWRGVIREYADRLPVTESTKVITLGEGGTPLVHAQKLSELTGSTVYLKVEGMNPTGS
FKDRGMTMAMTAAVASGAEAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQ
AIAHGATLLQVDGNFDNCLDIARKLGESYPVFLVNSVNPARIQGQKTGAFEVVDALGDAP
DIHVLPVGNAGNITAYWKGYKEYSAPFESDTAGTLPAVSTRTPQMWGFQAAGAAPFVAGH
PITEPDTIATAIRIGNPASWDGAIAARDESGGLIEAVTDDEILAAHRWLSAKEGVFVEPG
SAAGVAGLIKKHAAGQVPAGKTIVITVTGHGLKDPQWALRTEDGSDVQPVNVSNDVVTVA
AELGLEEK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaccaatggcgcggtgtcatccgcgaatacgctgatcgtttgcccgtaacggaa
agcaccaaagtcatcaccctcggtgagggcggcacgccgcttgtccacgcgcagaagctc
tccgagctgaccggttccaccgtgtacctcaaggtggaaggcatgaatcccaccggttcc
ttcaaggaccggggcatgaccatggccatgactgccgcggtggcctccggcgccgaggcc
gtggtgtgcgcctccaccggtaacacctccgcgtccgcggcggcctatgccacggcagcg
ggcctcaagtgcgccgtgctcgtcccggaaggcaagatttccatgggcaagctcagccag
gcgatcgcccacggcgccaccctcctgcaggtggacgggaacttcgacaactgcctggac
atcgcccggaagctgggggagtcctacccggtattcctggtgaactccgtcaacccggcc
cggatccaggggcagaaaaccggcgctttcgaagtcgtggacgcactcggcgacgccccg
gacatccacgtccttccggtagggaatgccggtaacatcaccgcgtactggaagggctac
aaggagtactcggcaccgttcgaatccgacactgccggcacccttcctgccgtgtccacc
aggaccccgcaaatgtggggcttccaggccgccggggcggcgccgtttgtcgccggccac
cccatcaccgagccggacaccatcgccacggcaatccggatcgggaaccccgcgtcctgg
gacggcgccatcgccgcccgtgacgaatccggcgggctgatcgaagcggttaccgacgac
gaaatcctggcagcgcaccgctggctgtccgccaaggaaggcgtcttcgttgaacccggt
tccgccgccggcgttgcaggcctgatcaagaagcacgccgccgggcaagtccccgccgga
aagaccatcgtgatcacggtgaccggccacggcctgaaggacccgcagtgggcgctgcgc
accgaagacggcagcgatgtccagccggtcaacgtgtccaacgatgtggtcaccgtggcc
gccgagctgggcctggaagaaaaatag

DBGET integrated database retrieval system