KEGG   Arthrobacter sp. FB24: Arth_2765Help
Entry
Arth_2765         CDS       T00421                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
art  Arthrobacter sp. FB24
Pathway
art00860  Porphyrin and chlorophyll metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
Module
art_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arth_2765
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Arth_2765
Exosome [BR:art04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arth_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABK04144
JGI: Arth2765
UniProt: A0JYM4
Position
complement(3117037..3118020)
Genome map
AA seq 327 aa AA seqDB search
MSFPTHRPRRLRTTPAMRRMTAENRLAAPELILPAFIREGLTEPNPIASMPGVVQHTTDS
LKKAAAEAVELGVGGIMLFGIPAERDARGTASLDPDGVLNKAIRDVRAEVGDDLVVMSDV
CLDEFTDHGHCGVLDDEGYVDNDATLEIYAAMAVAQADAGAHMLGPSGMMDGQIGVIRQA
LEDAGHTNTAVVAYAAKYASAFYGPFREAVDSQLKGDRRTYQMDSANRREALLEVELDLA
EGADLVMVKPAMSYLDILADVAAISTVPVAAYQISGEYSMIEAAAANGWIDRRAAITESV
LGIKRAGANMVLTYWASELAGWLKESR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcccgacccaccgcccccgccggctccgcaccaccccggccatgcgcaggatg
acggccgaaaaccgactggcggccccggagctgatccttcccgcgttcatccgcgagggg
ctcacggaacccaaccccatcgcctccatgcccggcgtggtgcagcacaccaccgattcg
ctcaagaaggcagcggccgaggccgtggaactgggtgtcggcggaatcatgcttttcggc
atccccgccgagcgcgatgcccggggtaccgcgtcgctggatcccgacggagtgctcaac
aaggccatccgggacgtccgcgctgaagtgggcgatgacctggtggtcatgagcgacgtg
tgcctggacgaattcaccgaccacggccactgcggcgtcctcgatgacgaaggctacgtg
gacaacgacgcgacgctggagatctacgcggcgatggccgtggcgcaggcggacgccggg
gcgcacatgcttggcccctcgggaatgatggacggccagatcggcgtgatccggcaggcg
ctggaagacgccgggcacaccaacacggccgtggtggcgtacgccgcaaagtacgcctcc
gcgttctatggtccgttccgggaagccgtggattcccagctcaagggcgaccgccgcacg
taccagatggactccgccaaccgccgcgaggccctcctcgaagtggagctggacctggcc
gaaggcgccgacctggtgatggtgaaacccgccatgagctacctggacatcctcgccgac
gtcgcggccatcagcaccgtgcccgtggctgcttaccagatctcgggggagtactccatg
atcgaggcggccgccgccaacggctggatcgaccggcgcgcggccattaccgaatccgtg
ctcggcatcaagcgggccggagccaacatggtcctgacctactgggcgtccgagctcgcc
ggctggctgaaggagtcccgatga

DBGET integrated database retrieval system