KEGG   Arthrobacter sp. FB24: Arth_2766Help
Entry
Arth_2766         CDS       T00421                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
art  Arthrobacter sp. FB24
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arth_2766
Enzymes [BR:art01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Arth_2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3118017..3118946)
Genome map
AA seq 309 aa AA seqDB search
MMGRRSARGEGRHGLRVLEGARVLVTRSPDRAGALLAALRETGAEPLLLPLIDFERARDL
HSLEVAFDALGAGAYTWLVISSVTTVQALEELARERGSTLSRWLPGSLQVATIGPATRRE
LELRGITVDLAPARLQSGVGLLDIWPQGQGSVFLPQADIADARLAEGLESLGARVQAVTA
YHTVDYPADPARSFTPSVGNDASAAPPGTGVLTPAEAKAELDAGRLHAVVAASPSAARRI
HAGLSPLGECRFVAIGRSTAAEAESLGLPVAAVAEEPTTSGLVSAVIEALAPGHATPPPA
TETYVKDRT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatggggcggcgcagtgcccgcggtgagggccgccacgggctgcgcgtcctcgagggc
gcccgcgtcctggtcacacgcagcccggaccgggcaggggcgctcctcgcggcccttcgg
gaaaccggcgccgaaccgctgctgctgccgctgatcgacttcgaacgcgcccgggacctg
cactccttggaagtcgccttcgacgccctgggcgccggcgcgtacacctggctggtgatc
agcagcgtcaccaccgtgcaggccctcgaggagctcgcccgtgaacggggctccacgctg
agccggtggctgcccggctccctccaagtggccaccattggccccgccacacgtcgcgaa
ctggaattacgcggaatcactgttgacctggccccggcccggctccagtccggcgtcgga
ctcctggacatctggccgcaaggccagggcagcgtattcctgccccaggcagacatagca
gatgcccggcttgccgaggggctggaatcactaggcgccagggttcaggctgtcaccgcc
tatcacacggtggactatccggccgatccggcccgcagcttcaccccttccgtcggcaac
gatgcgtcagccgcgcccccgggcactggagtgctcacccctgccgaagcaaaagccgag
ctcgacgccgggcggctccacgccgtcgtcgctgcttcacccagcgctgcccgccgcatc
catgcggggctgtcgccgctcggcgagtgcaggttcgtggcgatcggacgttcaacggca
gctgaggcggagtcgctgggcctgccggtggccgccgtcgctgaggaaccaacaacatcc
ggcctggtgtccgccgtcatcgaggcccttgcaccaggacatgccaccccaccgcccgcc
accgagacctacgtgaaggacagaacatga

DBGET integrated database retrieval system