KEGG   Arthrobacter sp. FB24: Arth_2838Help
Entry
Arth_2838         CDS       T00421                                 

Definition
aminotransferase AlaT (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Arth_2838
   01230 Biosynthesis of amino acids
    Arth_2838
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Arth_2838
   00290 Valine, leucine and isoleucine biosynthesis
    Arth_2838
Enzymes [BR:art01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Arth_2838
    2.6.1.66  valine---pyruvate transaminase
     Arth_2838
Amino acid related enzymes [BR:art01007]
 Aminotransferase (transaminase)
  Class I
   Arth_2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3192984..3194204)
Genome map
AA seq 406 aa AA seqDB search
MAEFKQSTKLHNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDDGD
EVLIPTPDYPLWTASVALASGRPVHYLCDEESGWQPDLEDLESKITPRTKGIVVINPNNP
TGAVYPEETLKKIVALAEKHGLVLFADEIYEKILYEDAVHVNLAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGISLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYDLLNAIPGVSTQQARGALYLFPKLDPEVFHIRDDEKFVLDLLREQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAIGRMGDFLSRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaagcagtccaccaagcttcataatgtcctctacgacatccgtggaccg
attcttcaggccgcccagcagatggaggcagagggtcaccggatcctcaaactgaacatc
ggaaacccggcaccgtttggttttgaagcgccggacgcgatcctggtggacatgatccgc
catctgccgcacgcccagggctacagtgactcccggggcatattctccgcccggacggca
gtgtcgcagtactaccagacccgcggtatccagaacattcacgtggacgacatttacctc
ggcaacggcgtcagcgagctcatcaccatgtcgctcatggcgctcctcgacgacggcgac
gaggttctgatccccacgcccgactacccgctctggaccgcctccgtcgccctcgcaagc
ggtcgcccggtgcactacctctgtgatgaggagtccggctggcagccggacctggaggac
ctcgaatccaagatcaccccgcgaaccaagggaatcgtggtgatcaacccgaacaacccc
accggtgcggtgtatcccgaggagaccctcaagaagattgtggccctggctgagaagcac
ggcctggtcctttttgcggatgaaatctacgagaagatcctgtacgaggacgctgtccac
gtgaacctggccggactcaccggcgacgacgtcctgtgcctgaccttcagcgggttgtcc
aaggcataccgcgtgtgcgggtaccgggccggctggatggcgatctccgggccaaagaag
gacgcggccgactacctcgaaggcatcagtctccttgcaaacatgcgcctgtgtgccaac
gtgcctgcccagcatgccatccagacggcattgggcggataccagagcatcaatgatctg
atcctgccagggggccgcctgctggaacagcggaacaaggcctacgacctgctcaacgcc
atccccggcgtcagcacgcagcaggccaggggagcgctgtacctgttcccgaaactggac
cccgaggtcttccacatccgggacgacgaaaagttcgtcctggacctgctccgtgagcag
aagatcctcgtttcccacggccgcgcctttaactgggtccgtccggatcacttccggatg
gtcaccctgcccaacgtgaaggatatagaagaagcaatcggccgtatgggggacttcctg
agccggtaccaggggaactag

DBGET integrated database retrieval system