KEGG   Arthrobacter sp. FB24: Arth_2838Help
Entry
Arth_2838         CDS       T00421                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
art00220  Arginine biosynthesis
art00250  Alanine, aspartate and glutamate metabolism
art00290  Valine, leucine and isoleucine biosynthesis
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01130  Biosynthesis of antibiotics
art01210  2-Oxocarboxylic acid metabolism
art01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Arth_2838
   00290 Valine, leucine and isoleucine biosynthesis
    Arth_2838
   00220 Arginine biosynthesis
    Arth_2838
Enzymes [BR:art01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Arth_2838
    2.6.1.66  valine---pyruvate transaminase
     Arth_2838
Amino acid related enzymes [BR:art01007]
 Aminotransferase (transaminase)
  Class I
   Arth_2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABK04217
JGI: Arth2838
UniProt: A0JYU7
Position
complement(3192984..3194204)
Genome map
AA seq 406 aa AA seqDB search
MAEFKQSTKLHNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDDGD
EVLIPTPDYPLWTASVALASGRPVHYLCDEESGWQPDLEDLESKITPRTKGIVVINPNNP
TGAVYPEETLKKIVALAEKHGLVLFADEIYEKILYEDAVHVNLAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGISLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYDLLNAIPGVSTQQARGALYLFPKLDPEVFHIRDDEKFVLDLLREQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAIGRMGDFLSRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaagcagtccaccaagcttcataatgtcctctacgacatccgtggaccg
attcttcaggccgcccagcagatggaggcagagggtcaccggatcctcaaactgaacatc
ggaaacccggcaccgtttggttttgaagcgccggacgcgatcctggtggacatgatccgc
catctgccgcacgcccagggctacagtgactcccggggcatattctccgcccggacggca
gtgtcgcagtactaccagacccgcggtatccagaacattcacgtggacgacatttacctc
ggcaacggcgtcagcgagctcatcaccatgtcgctcatggcgctcctcgacgacggcgac
gaggttctgatccccacgcccgactacccgctctggaccgcctccgtcgccctcgcaagc
ggtcgcccggtgcactacctctgtgatgaggagtccggctggcagccggacctggaggac
ctcgaatccaagatcaccccgcgaaccaagggaatcgtggtgatcaacccgaacaacccc
accggtgcggtgtatcccgaggagaccctcaagaagattgtggccctggctgagaagcac
ggcctggtcctttttgcggatgaaatctacgagaagatcctgtacgaggacgctgtccac
gtgaacctggccggactcaccggcgacgacgtcctgtgcctgaccttcagcgggttgtcc
aaggcataccgcgtgtgcgggtaccgggccggctggatggcgatctccgggccaaagaag
gacgcggccgactacctcgaaggcatcagtctccttgcaaacatgcgcctgtgtgccaac
gtgcctgcccagcatgccatccagacggcattgggcggataccagagcatcaatgatctg
atcctgccagggggccgcctgctggaacagcggaacaaggcctacgacctgctcaacgcc
atccccggcgtcagcacgcagcaggccaggggagcgctgtacctgttcccgaaactggac
cccgaggtcttccacatccgggacgacgaaaagttcgtcctggacctgctccgtgagcag
aagatcctcgtttcccacggccgcgcctttaactgggtccgtccggatcacttccggatg
gtcaccctgcccaacgtgaaggatatagaagaagcaatcggccgtatgggggacttcctg
agccggtaccaggggaactag

DBGET integrated database retrieval system