KEGG   Arthrobacter sp. FB24: Arth_2849Help
Entry
Arth_2849         CDS       T00421                                 

Definition
(GenBank) cystathionine gamma-synthase (EC:2.5.1.48)
  KO
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
art  Arthrobacter sp. FB24
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arth_2849
  Energy metabolism
   00920 Sulfur metabolism
    Arth_2849
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Arth_2849
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Arth_2849
Enzymes [BR:art01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Arth_2849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3205164..3206327)
Genome map
AA seq 387 aa AA seqDB search
MLSPDSLAVHAGRAGLTEQGVHAVPIDLSTTAPLPSVHDGGLAYEQMATGGMPLEGQSTV
YQRLWNPTVARFEEGVAVLEGAPEAVAFATGMAALSAVLLATVAAGRKHVVAVRPLYGGS
DHILASGVLGTEVTFTTADGVRDALRPDTGLVIVETPANPSLELVDIAQLARDADGVPLL
VDNTFASPVLQQPLAHGATLVLHSATKFLGGHGDAMGGVVAAPVEWTTRLRQVRAVTGGI
LTPWPAYLLHRGLATLPVRVRAQQATAHKVAAALAGHGLVKAVHYPGLPECDPLGLVGTQ
MSGPGSLLAFELASAEHAERVPAAVRMITHAVSLGGIDTLIQHPAGLTHRPVAAGARPRA
SLLRLSVGLEDVTDIVADLLQAVEGTR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgctttctcccgattcactggctgtccatgcaggccgggccggcctcaccgaacaaggc
gtgcatgccgtgccgattgacctctccaccactgcgccgcttccgtcggtccacgacggc
ggcctggcctatgaacaaatggccaccggcgggatgcccctggaaggccagagcaccgtc
taccagcgtttgtggaatcccacggtggcccgcttcgaggagggcgtggccgtcctggag
ggtgcgcccgaggcggtggccttcgccaccgggatggcggccctttcggctgtcctgctc
gcgactgtggctgccggcaggaagcacgtggtggcagtccgcccgttgtatggcgggagt
gaccacatcctcgcctcgggcgtcctgggcaccgaagtgacgttcacgacggcggacggt
gttcgcgatgccctgcgtccggacacgggactggtgattgtggagacgcccgccaacccc
agcctggagcttgtggacattgcgcagctcgcccgtgacgctgacggcgtcccgctcctg
gtggacaacaccttcgcaagcccggtgctccaacagcccctcgctcacggggccacgctc
gtgttgcacagcgccaccaaattcctcggcggccacggggatgcgatgggcggtgtggtt
gcggctccggtggagtggaccaccaggctccgccaggtccgtgccgtgacaggcggaatc
ctgactccctggccggcctatctgctccaccgcgggctggccaccttgccggtgcgcgtc
cgggcgcagcaggcaaccgcccacaaggttgctgctgccctggccggacacgggctcgtg
aaagccgtccactacccggggcttccggagtgcgacccgctgggtctggtggggacgcag
atgtccggccccggctcgctgctcgcgtttgaactggccagcgccgagcacgccgaacgg
gtgccggcggcggtccggatgatcacccacgccgtgtccctgggcggcatcgataccctc
attcagcacccggccggactgacccaccggcccgttgccgccggggccaggccgcgtgcg
agcctgcttcgattgtccgtggggctggaggacgtcacggacattgtggcggaccttctg
caggcagtcgaaggaacgcgctag

DBGET integrated database retrieval system