KEGG   Arthrobacter sp. FB24: Arth_2849Help
Entry
Arth_2849         CDS       T00421                                 

Definition
cystathionine gamma-synthase (EC:2.5.1.48)
Orthology
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
art  Arthrobacter sp. FB24
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arth_2849
  Energy metabolism
   00920 Sulfur metabolism
    Arth_2849
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Arth_2849
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Arth_2849
Enzymes [BR:art01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Arth_2849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(3205164..3206375)
Genome map
AA seq 403 aa AA seqDB search
MPETCRIQWRIIQRSLVLSPDSLAVHAGRAGLTEQGVHAVPIDLSTTAPLPSVHDGGLAY
EQMATGGMPLEGQSTVYQRLWNPTVARFEEGVAVLEGAPEAVAFATGMAALSAVLLATVA
AGRKHVVAVRPLYGGSDHILASGVLGTEVTFTTADGVRDALRPDTGLVIVETPANPSLEL
VDIAQLARDADGVPLLVDNTFASPVLQQPLAHGATLVLHSATKFLGGHGDAMGGVVAAPV
EWTTRLRQVRAVTGGILTPWPAYLLHRGLATLPVRVRAQQATAHKVAAALAGHGLVKAVH
YPGLPECDPLGLVGTQMSGPGSLLAFELASAEHAERVPAAVRMITHAVSLGGIDTLIQHP
AGLTHRPVAAGARPRASLLRLSVGLEDVTDIVADLLQAVEGTR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgccagagacttgccggattcaatggcgaataattcaaaggagtctcgtgctttctccc
gattcactggctgtccatgcaggccgggccggcctcaccgaacaaggcgtgcatgccgtg
ccgattgacctctccaccactgcgccgcttccgtcggtccacgacggcggcctggcctat
gaacaaatggccaccggcgggatgcccctggaaggccagagcaccgtctaccagcgtttg
tggaatcccacggtggcccgcttcgaggagggcgtggccgtcctggagggtgcgcccgag
gcggtggccttcgccaccgggatggcggccctttcggctgtcctgctcgcgactgtggct
gccggcaggaagcacgtggtggcagtccgcccgttgtatggcgggagtgaccacatcctc
gcctcgggcgtcctgggcaccgaagtgacgttcacgacggcggacggtgttcgcgatgcc
ctgcgtccggacacgggactggtgattgtggagacgcccgccaaccccagcctggagctt
gtggacattgcgcagctcgcccgtgacgctgacggcgtcccgctcctggtggacaacacc
ttcgcaagcccggtgctccaacagcccctcgctcacggggccacgctcgtgttgcacagc
gccaccaaattcctcggcggccacggggatgcgatgggcggtgtggttgcggctccggtg
gagtggaccaccaggctccgccaggtccgtgccgtgacaggcggaatcctgactccctgg
ccggcctatctgctccaccgcgggctggccaccttgccggtgcgcgtccgggcgcagcag
gcaaccgcccacaaggttgctgctgccctggccggacacgggctcgtgaaagccgtccac
tacccggggcttccggagtgcgacccgctgggtctggtggggacgcagatgtccggcccc
ggctcgctgctcgcgtttgaactggccagcgccgagcacgccgaacgggtgccggcggcg
gtccggatgatcacccacgccgtgtccctgggcggcatcgataccctcattcagcacccg
gccggactgacccaccggcccgttgccgccggggccaggccgcgtgcgagcctgcttcga
ttgtccgtggggctggaggacgtcacggacattgtggcggaccttctgcaggcagtcgaa
ggaacgcgctag

DBGET integrated database retrieval system