KEGG   Arthrobacter sp. FB24: Arth_3003Help
Entry
Arth_3003         CDS       T00421                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
art  Arthrobacter sp. FB24
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arth_3003
   01230 Biosynthesis of amino acids
    Arth_3003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_3003
   00030 Pentose phosphate pathway
    Arth_3003
   00051 Fructose and mannose metabolism
    Arth_3003
   00052 Galactose metabolism
    Arth_3003
  Energy metabolism
   00680 Methane metabolism
    Arth_3003
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Arth_3003
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Arth_3003
Protein phosphatases and associated proteins [BR:art01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Arth_3003
Messenger RNA biogenesis [BR:art03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Arth_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3370931..3371956
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGHEFVGFLDGWRGVVEGDVIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPDVIKGHMDRLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMASGAHAILIPEQKASMDQITEWVQEAHDRGRAPLVVVAEGFVPEGQETPHSERGLDTF
GRPRLGGIAEMLAPELEARTGIETRATVLGHIQRGGVPSAFDRVLATRLGMAAIDSVVDQ
RWGTMVSLNGTDIVHVGFDAALGNLKSVPQHRYDEAAVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaattctcaccagcggtggcgactgccccggactgaacgccgttatccgc
ggtgccgtcctcaaaggaatcgccatccacggccacgaattcgtaggattcctcgacggc
tggcgcggcgtcgtcgaaggcgacgtgatcgacattccccgaaccatggtccgcggcatc
gcgaagcagggcggcaccatcctcggcacgtcccggaccaacccgttcgaaaacggcggc
gggcccgatgtcatcaagggccacatggaccggctcggcatcgacgcgatcatcgccatc
ggcggcgaaggtacgctggccgcagccaagcggctgaccgacgccggactgaagatcgtc
ggcgttcccaagacagtggacaacgaccttgacgcgacggactacacgttcggcttcgac
acagctgtccagatcgccaccgaggccatagaccgcctccgcaccaccggtgaatcgcac
caccgttgcatgatcgccgaagtcatgggccgccacgtgggctggattgccctgcacgcg
ggcatggcatccggcgcacacgccatcctcattccggagcagaaggcctccatggaccag
atcaccgagtgggtgcaggaagcccatgaccgtggccgcgcgcccttggtggttgtggct
gagggcttcgttccggaaggccaggaaacgccgcactccgagcgcggcctggacaccttc
ggacgcccgcggctgggcggcatcgccgaaatgctggctcccgagcttgaggcacgcacc
ggtattgagacccgggccaccgtcctgggtcacatccagcgcggcggcgtcccgtccgca
ttcgaccgagtcctggccacgcggctgggcatggccgccatcgactccgttgtggaccag
cgctggggcaccatggtgtccctcaacggcacggacattgtgcacgtcggcttcgacgcc
gccctgggcaacctcaagagcgttccgcagcaccgctacgacgaggccgccgtcctcttc
ggctag

DBGET integrated database retrieval system