KEGG   Arthrobacter sp. FB24: Arth_3003Help
Entry
Arth_3003         CDS       T00421                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00030  Pentose phosphate pathway
art00051  Fructose and mannose metabolism
art00052  Galactose metabolism
art00680  Methane metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_3003
   00030 Pentose phosphate pathway
    Arth_3003
   00051 Fructose and mannose metabolism
    Arth_3003
   00052 Galactose metabolism
    Arth_3003
  Energy metabolism
   00680 Methane metabolism
    Arth_3003
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Arth_3003
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Arth_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABK04382
JGI: Arth3003
UniProt: A0JZB2
Position
3370931..3371956
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGHEFVGFLDGWRGVVEGDVIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPDVIKGHMDRLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMASGAHAILIPEQKASMDQITEWVQEAHDRGRAPLVVVAEGFVPEGQETPHSERGLDTF
GRPRLGGIAEMLAPELEARTGIETRATVLGHIQRGGVPSAFDRVLATRLGMAAIDSVVDQ
RWGTMVSLNGTDIVHVGFDAALGNLKSVPQHRYDEAAVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaattctcaccagcggtggcgactgccccggactgaacgccgttatccgc
ggtgccgtcctcaaaggaatcgccatccacggccacgaattcgtaggattcctcgacggc
tggcgcggcgtcgtcgaaggcgacgtgatcgacattccccgaaccatggtccgcggcatc
gcgaagcagggcggcaccatcctcggcacgtcccggaccaacccgttcgaaaacggcggc
gggcccgatgtcatcaagggccacatggaccggctcggcatcgacgcgatcatcgccatc
ggcggcgaaggtacgctggccgcagccaagcggctgaccgacgccggactgaagatcgtc
ggcgttcccaagacagtggacaacgaccttgacgcgacggactacacgttcggcttcgac
acagctgtccagatcgccaccgaggccatagaccgcctccgcaccaccggtgaatcgcac
caccgttgcatgatcgccgaagtcatgggccgccacgtgggctggattgccctgcacgcg
ggcatggcatccggcgcacacgccatcctcattccggagcagaaggcctccatggaccag
atcaccgagtgggtgcaggaagcccatgaccgtggccgcgcgcccttggtggttgtggct
gagggcttcgttccggaaggccaggaaacgccgcactccgagcgcggcctggacaccttc
ggacgcccgcggctgggcggcatcgccgaaatgctggctcccgagcttgaggcacgcacc
ggtattgagacccgggccaccgtcctgggtcacatccagcgcggcggcgtcccgtccgca
ttcgaccgagtcctggccacgcggctgggcatggccgccatcgactccgttgtggaccag
cgctggggcaccatggtgtccctcaacggcacggacattgtgcacgtcggcttcgacgcc
gccctgggcaacctcaagagcgttccgcagcaccgctacgacgaggccgccgtcctcttc
ggctag

DBGET integrated database retrieval system