KEGG   Arthrobacter sp. FB24: Arth_3019Help
Entry
Arth_3019         CDS       T00421                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
art  Arthrobacter sp. FB24
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:art00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:art00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3387574..3388158
Genome map
AA seq 194 aa AA seqDB search
MSTDNAMDPLAFTEKIADGTTGVGLVWAQTTAGVIGKDGDMPWHLPEDMKHFTRLTTGHP
VIMGRKTWLSFPDKYRPLPGRTNIVVTRQEGWGDTPDARGAIAVKSLDDALLESQFAPGH
ETVWVLGGGEIFAQTLDIADVAVVTFIDSETDGDTYAPELGYEWKLAASEPATGWLTSAT
GTRYRFTMWRRTEA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacaacgccatggatcccctggccttcactgaaaaaattgccgacggaacc
accggagtggggctcgtctgggcccagaccacggcaggtgtgatcggcaaggacggcgac
atgccgtggcaccttcccgaggacatgaagcacttcacccggctcaccaccgggcacccg
gtgatcatggggcgcaaaacctggctctcgttcccggacaagtaccgtccgctgcccggg
cgcaccaacattgtggtgacgcgccaggagggctggggcgacactcccgacgcccggggc
gccatcgcggtgaaatcgctcgacgacgcgctgctggaatcacagttcgcgcccggccac
gaaacggtgtgggtgctgggcggcggggaaatcttcgcgcagaccctggacatcgccgac
gtcgcagtggtgacattcatcgactccgagaccgacggcgacacgtacgcgcccgagctc
ggttacgagtggaagctggccgccagcgagccggccaccggctggctgacgtctgccacc
ggtacccgttaccggttcacgatgtggcgccggacggaggcctag

DBGET integrated database retrieval system