KEGG   Arthrobacter sp. FB24: Arth_3019Help
Entry
Arth_3019         CDS       T00421                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
art  Arthrobacter sp. FB24
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arth_3019
   00670 One carbon pool by folate
    Arth_3019
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Arth_3019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3387574..3388158
Genome map
AA seq 194 aa AA seqDB search
MSTDNAMDPLAFTEKIADGTTGVGLVWAQTTAGVIGKDGDMPWHLPEDMKHFTRLTTGHP
VIMGRKTWLSFPDKYRPLPGRTNIVVTRQEGWGDTPDARGAIAVKSLDDALLESQFAPGH
ETVWVLGGGEIFAQTLDIADVAVVTFIDSETDGDTYAPELGYEWKLAASEPATGWLTSAT
GTRYRFTMWRRTEA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacaacgccatggatcccctggccttcactgaaaaaattgccgacggaacc
accggagtggggctcgtctgggcccagaccacggcaggtgtgatcggcaaggacggcgac
atgccgtggcaccttcccgaggacatgaagcacttcacccggctcaccaccgggcacccg
gtgatcatggggcgcaaaacctggctctcgttcccggacaagtaccgtccgctgcccggg
cgcaccaacattgtggtgacgcgccaggagggctggggcgacactcccgacgcccggggc
gccatcgcggtgaaatcgctcgacgacgcgctgctggaatcacagttcgcgcccggccac
gaaacggtgtgggtgctgggcggcggggaaatcttcgcgcagaccctggacatcgccgac
gtcgcagtggtgacattcatcgactccgagaccgacggcgacacgtacgcgcccgagctc
ggttacgagtggaagctggccgccagcgagccggccaccggctggctgacgtctgccacc
ggtacccgttaccggttcacgatgtggcgccggacggaggcctag

DBGET integrated database retrieval system