KEGG   Arthrobacter sp. FB24: Arth_3191Help
Entry
Arth_3191         CDS       T00421                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00020  Citrate cycle (TCA cycle)
art00620  Pyruvate metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_3191
   00020 Citrate cycle (TCA cycle)
    Arth_3191
   00620 Pyruvate metabolism
    Arth_3191
Enzymes [BR:art01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Arth_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABK04569
JGI: Arth3191
UniProt: A0JZU9
Position
complement(3595441..3596997)
Genome map
AA seq 518 aa AA seqDB search
MSETKVFLLPDLGEGLTEAELVNWLVAVGDEIRVDQPIAEVETAKSMVEVPSPYAGTVAV
LHGEPGQTLDVGKPLISVAPTGTLVVEPVETKPVETKPVETAAAETYREEEKAGSGNVLI
GYGTPGGHGVARRTRARKQPVVEPVETGSVATHTPVVEPFRSVVEPVETTSAEKSADDVL
LLRTRVPGKLGAVISPLVRRMARDHGVDLGGLQGSGASGLIMRKDVEAAIAPAPEVKPPS
VVEPVETRRPVAAARSVDDRRSVVEPVETRHRETDPRTGLGITARTPVRGVRKAVAANMT
RSRSEIPEATVWVDVDATALVEMRAALKKSDPHNTPGLLAFIARFVTAGLKKYPELNTRI
VTTEDAAGGESQEIVAFDGINLGFAAQTDRGLMVPSVRNAGKMSARELDAEIRRLTAVVR
EGKATPSELGSGTFTLNNYGVFGVDGSAAIINHPEVGILGVGRIIDKPWVVNGELAVRKV
TELTLTFDHRVCDGGTAGGFLRYVADAIENPGSVLADM
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacgaaagtattcctgctgccggacctgggcgaaggcctcaccgaagccgag
cttgtgaactggctcgtggccgtgggcgacgaaatccgggtggaccagcccatcgccgag
gtcgagaccgcgaagtccatggtggaagtcccgtccccgtacgccggcacagttgccgtg
cttcacggagagccaggccagaccctggacgtcggcaagccgctgatttcggtcgcgccc
actggcaccttggtggtcgagcctgtcgagaccaagcccgtcgagaccaagcctgtcgaa
accgccgccgccgaaacttaccgggaagaggaaaaagccggctccggcaacgtcctcatc
ggctacggaacacccggcggccacggtgtagcccgccgcacgcgcgcgcggaagcagccg
gtcgtcgagcctgtcgagaccggttctgtcgcaactcacaccccggtagttgagcctttc
cgttcggtggttgagcctgtcgaaaccacaagtgcggaaaagtccgccgacgatgtcctg
ctcctgcgcacacgcgtgccgggaaaattgggggcggtgatttcgccgctcgtccgccgg
atggcccgtgaccacggagttgacctgggaggactccaaggatcaggcgcaagcgggctg
atcatgcgcaaggacgtcgaggcggccatagctcccgcgcccgaggtaaagccgccttcg
gtggttgagccagtcgaaacccgccgccccgtggccgcggcgcgttcggtggatgaccga
cgttcggtggttgagcctgtcgaaacccgccatcgtgaaaccgacccacgaacaggcctc
ggcatcacagcacgaacgccggtccgaggagtccgcaaggcagtggccgcgaacatgacg
cgaagccgctccgagatcccagaagccactgtatgggtcgatgtggatgccacagcgctt
gtggaaatgcgtgcggcgcttaagaagtccgatccgcacaacaccccggggctgctggca
ttcatcgcacggtttgtgacggcgggactgaagaagtatccggagctgaataccagaatt
gtcaccacagaggacgccgcaggtggggagagccaggaaatcgtcgcgttcgacggtata
aacctgggcttcgccgcgcagacggaccggggacttatggtgccatcggtgcgcaatgcg
ggcaagatgagcgcccgtgagttggacgctgagattcgcaggctcacagcggtcgtgcgt
gaaggcaaggcgacaccttcagagctgggaagtggcaccttcactctgaacaactatggg
gtcttcggagtggacggctcagcagcgatcatcaatcacccggaggttggaatcttgggc
gtagggcgcatcatcgacaagccttgggtggtcaacggcgagctggccgtccgcaaggtc
acggagctaacactcaccttcgatcaccgcgtgtgcgacggcggaacggcgggcggcttc
ctgcggtacgtggctgatgcgatcgagaacccggggtccgtgctggcagatatgtag

DBGET integrated database retrieval system