KEGG   Arthrobacter sp. FB24: Arth_3211Help
Entry
Arth_3211         CDS       T00421                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
art  Arthrobacter sp. FB24
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arth_3211
   00052 Galactose metabolism
    Arth_3211
   00500 Starch and sucrose metabolism
    Arth_3211
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_3211
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Arth_3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3619123..3620094)
Genome map
AA seq 323 aa AA seqDB search
MGRPPHEPRNLGRELPVSSNDLYGSAMTLGKSVRKAVIPAAGLGTRFLPATKAMPKEMLP
VVDQPAIQYVVEEAVKAGLTDLLMITGRQKRALEDHFDRAPALERTLELKGDLDRLEAVQ
HASSLAPLHYLRQGDPKGLGHAVLCARQHVGDEPFAVLLGDDLIDERDELLSTMIDVQAK
TGGSVIALIEVDPSQISAYGCADITPVDGENYFQVNRLVEKPSVDEAPSNLAVIGRYVLH
PAVFDVLEETEPGRGGEIQLTDALQTLATSDGEGGGVYGVVFRGRRYDTGDKLSYIKAVI
SIASERVDFGEDLKAWMKEFVND
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggcctccccatgagccgcgtaatcttggccgtgaattgccagtttcctcaaac
gatttgtatggttcagctatgactttggggaaatcagtaagaaaagccgtcattcctgct
gccggtttgggaactcgcttcctgcccgccaccaaggcgatgccgaaggaaatgttgccg
gttgttgaccagcccgcaatccagtacgtggtggaggaagccgtcaaggcagggctgacg
gacctcctgatgatcaccggacgccagaagcgggccctggaggaccactttgaccgggca
cctgccctggagcggaccttggagcttaagggcgacctggaccggctggaggctgtccag
cacgcctccagcctcgctccgctgcactacctgcgccagggagatcccaagggtctgggc
cacgcggtgctgtgcgcgcgccagcacgtgggggacgagccgttcgccgtcctgcttggt
gacgacctcatcgacgaacgggatgagctgctgagcaccatgatcgacgtgcaggccaag
accggaggctccgtcatcgcactgatcgaagtggacccgtcccagatcagcgcctacggc
tgcgcggacatcacgcccgtggacggcgagaactattttcaggtgaaccgcctggtggaa
aagccctctgtagacgaagccccctccaacctggcagtcatcggccgttacgtgctgcac
ccggccgtgtttgatgtgctggaagaaaccgagccgggccgcggcggtgagatccagctg
acggacgccctgcagaccctggcaacgtctgacggcgaaggcgggggcgtttatggcgtg
gtgttccgcgggcgccgctacgacaccggagacaagctcagctacatcaaggcggttatt
tccatcgcctcggagcgcgtcgacttcggcgaggacctcaaggcctggatgaaggaattc
gtgaacgactaa

DBGET integrated database retrieval system