KEGG   Arthrobacter sp. FB24: Arth_3325Help
Entry
Arth_3325         CDS       T00421                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
art  Arthrobacter sp. FB24
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arth_3325
Enzymes [BR:art01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Arth_3325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3733230..3735245
Genome map
AA seq 671 aa AA seqDB search
MSSQENPTPPAVWSSLEGIAYGGDYNPEQWPVSTRQEDLDLMKEAGVTFLSVGIFSWGLL
EPSEGDYDFGWLDDALDNLAAAGIKVALATATAAPPAWLVRKHPEILPVTADGTVLGPGS
RRHYTPSSAVYRRYATGITRVLAERYKDHPALALWHVDNELGCHVSEFYGDEDATAFRRW
LERRYGSIDALNAAWGTAFWSQHYSSFEEVLPPAAAPSTLNPGQQLDFQRFSSWALMDYY
RALLEVLRDVTPGVPATTNLMVSSATKSMDYFDWAKDLDVIANDHYLVAADPERQIELAF
SADLTRGVAGGDPWILMEHSTSAVNWQPRNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SFAGSEKFHSAMVPHGGRDTRIFHEVVGLGAALQKLAAVRGSRVESRVAIVFDYEAWWAS
ELDSHPSQDVKYLDLMRAFHRSLFLRGVSTDFVHPSASLEGYDLVLVCTLYNVTDPAAAS
IASAARAGATVLVSYFSGIVDEQDHIRLGGYPGAFRELLGIRVEEFHPLLTGATAKLSDG
RVGTVWSEHVHLAGAEPVQTFTEYPLEGVPALTRRSVGTGSAWYLATFPDRDGIEALVDR
LLADSGVSAVAEADQGVELTRRRTGDGTSFIFAINHSRADATVRVAGAELLSGERFTGTV
PAGGVAVIAED
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcccaggaaaatcccactccacccgcagtgtggagcagcctcgaaggtatcgcc
tacgggggcgactacaaccccgagcagtggcctgtcagcacccggcaggaagacctggac
ctcatgaaggaagccggcgtcacgttcctcagcgtgggcattttttcctggggcctgctg
gaaccgtccgagggcgactacgattttggctggctggacgacgccctggacaacctggca
gcagcaggcatcaaggtggccctcgcgaccgcaaccgccgcgcccccggcatggttggtg
cgcaagcacccggaaatcctcccggtcaccgctgacggaaccgtgctggggccgggctcc
cggcggcactacacgccgtcgtcggccgtttaccggcggtacgcaaccggcatcacccgg
gtgctggcagagcgctacaaggaccacccggcactggcgctgtggcacgtggacaacgaa
ctcggctgccacgtttcggagttctacggcgacgaggacgccactgccttccgccgttgg
cttgagcgtcggtacgggagcatcgatgccctgaacgcggcgtggggaacggcgttctgg
tcccagcactactcctcgttcgaggaggtcctgccgccagcggcggcgccgtccacgctt
aatccggggcagcagctggacttccagcgcttcagctcctgggccctgatggactattac
cgcgccctcctcgaggtgctgcgcgacgtaacgcccggggtgcctgccaccaccaacctc
atggtttccagcgccaccaaatccatggactacttcgactgggccaaggacctggacgtg
atcgccaacgaccactacctcgtggccgccgatccggagcgtcagatcgaacttgcgttc
agtgcggacctcacgcgcggcgttgccggcggtgacccgtggatactgatggaacattcg
acgtcggcagtgaactggcagccccgcaaccagcccaagatgcccggcgaaatgctgcgc
aactccctggcgcacgtggcccgcggcgctgatgccgttatgttcttccagtggcggcag
agcttcgccggttcggagaagttccactccgctatggtgccccacggcggacgggacacc
cgcatcttccacgaggtggtggggctcggcgccgcactccagaagctggccgcggtgcgg
ggatcgcgcgttgagtcgcgcgtggccatcgtcttcgactacgaggcctggtgggccagc
gaactcgattcccaccccagccaggacgtgaaatacctcgacctgatgcgcgccttccac
cgctcgctgttcctgcgcggggtttcgacggattttgtgcacccttccgcctccctggag
ggctacgacctggtgctggtgtgcaccctgtacaacgtcaccgacccggctgccgccagc
atcgcatcggctgcccgcgccggcgcaacagtcctggtgagctatttcagcgggattgtg
gacgaacaggaccacatccgcctcggcgggtacccgggcgccttccgggagctgctgggc
atcagggtggaggaattccaccccctgctgaccggtgccacggccaagctcagcgacggc
cgagtgggcacggtatggagcgagcacgtgcacttggccggggctgaaccggtacagacg
ttcactgaatacccgttggagggcgtccccgccctgacccggcgctccgtcggaacgggc
tcggcctggtacctggccaccttcccggaccgcgacggcatcgaggcgctggtggaccgg
ttgctcgctgattccggagtttccgcagtggcggaggcggaccagggcgttgaactgacg
cgacgccgcaccggcgacggcaccagcttcatcttcgccatcaaccactcacgcgccgat
gccacggtccgcgtggcaggggcagagctgctgtccggcgagcggttcaccggcacggtt
ccggctggcggcgtggcggtgatcgcggaggactga

DBGET integrated database retrieval system