KEGG   Arthrobacter sp. FB24: Arth_3388Help
Entry
Arth_3388         CDS       T00421                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
art  Arthrobacter sp. FB24
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arth_3388
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arth_3388
   00600 Sphingolipid metabolism
    Arth_3388
Enzymes [BR:art01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Arth_3388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3810231..3812438
Genome map
AA seq 735 aa AA seqDB search
MDPLHLRSAGTSLVISFDSGEAEVIHWGADLGASLPDLAILGEPIPPSAIDASVPAGLLP
QASSSWRGRPALRGHRIADGVPGYDFSVRLRVTDVKTAGSSAVIVQSDPDAGISVESTLE
LHAGGLLEMRHTVTNTGTSPFQLDELATVLPVAPDAVELLDLTGRWCRERHPQRRAIQQG
TWVRTGRHGRTGHDSSLLLAAGTAGFGNRHGKVWATHLAWSGNHEQFADSIGDGRTVIGG
SELLGPAEVVLQPNGSYTTPALFAAYSDRGLDGISEAFYSWFRNRPHHVLPSASAVSGAA
HAGTGKARPVVLNVWEAVYFNHDLGVLVELADSAADLGVERFVLDDGWFRGRRHDQAGLG
DWYVDEGLWPDGLTPLIDAVTSRGMEFGLWVEPEMINLDSDTARAHPDWIVGPAARSHKD
GGRLPLTWRHQHVIDLVNPEAWQYVFDRIDALLRENNISYLKWDQNRDLTEHGHAGRASV
HEQTLAAYRLFDELRKAHPGLEIESCSSGGARVDLGILERTDRIWASDCNDALERQTIQR
WTGLVVPPELVGGHIGPTTSHTTARTHDVSFRAITALFGHFGLEWDVRQVHGAEREELKR
FIGLYKEHRGLIHSGRMVRADVADDSLMLHGVVSHGSPATGDTAALFALVSTRTSPAERP
GRIAIPGLDQDRSYRVEAIFPTPGDADYAHNYTQAQPPAWLTAGAEASGRFLSEVGLPMP
VLNPEHALLLSFTAV
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggatcccctgcacctccgctccgccggcaccagcctggtgatcagcttcgacagcggg
gaggccgaggtcattcactggggcgccgatctgggcgcttcactccccgatctggccatc
ctcggcgaaccgatcccgccctccgccatcgacgcctccgtccccgccgggctgctgccg
caggcatcctccagctggcgtggacgcccggccctccgggggcaccggatcgccgacggc
gtgcccggctacgacttttccgtccgcctgcgcgtcacggacgtcaagaccgcaggaagt
tcagctgtgatcgtccagtctgatcccgatgccggaatctctgttgaatccacgctggaa
ctgcacgccggcgggctgctggaaatgcgccacaccgtcaccaacaccggcacttcgcct
tttcagctcgacgaactggccacggtgctgccggtggctcccgacgccgtcgaactcctt
gacctgaccggacgctggtgccgtgaacgccaccctcagcgccgcgccatccagcagggc
acctgggtgcggaccggccggcacggccggaccggccacgactcctccctgctgctggcc
gccggcacggcaggcttcggcaaccgccacggcaaggtctgggccacccaccttgcctgg
agcggaaaccatgagcagttcgcggacagcatcggggacggacggaccgtcatcggtggt
tccgagctgctgggtccggccgaagtggtcctccagccgaacggcagctacaccaccccc
gctctcttcgcggcctactcggaccgcggcctggacggtatcagcgaagcgttctacagc
tggttcaggaaccggccgcaccatgtgctgccttcggcgtcagccgtctcaggagcagct
catgcgggcaccggcaaggcccggcctgtagtgctaaacgtctgggaagctgtctacttc
aaccacgatctgggtgtattggtcgaacttgccgattccgcggcggacctgggcgtggag
cgctttgtcctcgacgacgggtggttccgcggccgccggcacgaccaggcaggcctgggc
gactggtacgtggacgagggcctctggccggacgggctcacacccctgatcgacgccgtc
acatcgcgcggcatggaattcggcctctgggtggagcccgaaatgatcaacctggactcc
gacaccgcgcgcgcccacccggactggatcgtcgggccggccgcacggtcccacaaggac
ggcggccggctgccgttgacctggcgccaccagcacgtcatcgacctggtcaatcccgag
gcctggcagtacgttttcgaccgcattgacgccctgttgcgcgaaaacaacatcagctac
ctgaagtgggaccagaaccgggacctcaccgagcacggccacgccgggcgcgcctccgtc
cacgaacagaccctggccgcctaccgcctcttcgatgagctcaggaaagcccatccgggc
ctcgaaatcgagagctgctcttccggcggggcacgcgtggacctgggcatcctggaacgc
acggaccggatctgggcttcggactgcaacgatgccctggaacgccagaccatccagcgc
tggaccgggctggtggtgccgccggaactggtcggaggacacatcggccccactacgtca
cacaccacggcccgcacgcacgacgtttcgttccgcgccatcacggccctgttcggacac
ttcggcctcgaatgggacgtccgccaggttcacggcgcggagcgcgaagaactcaagcgg
ttcatcgggctctacaaggagcaccgcggcctgatccactcgggccggatggtccgggcg
gatgttgccgacgattcgctgatgctgcacggcgtcgtttcccacggcagcccagcaacc
ggggacacggcggcactgttcgcgctggtcagcaccaggacgtcgcccgcggagcgtccg
ggccgcatcgccattccgggactggaccaggaccgcagctaccgcgtggaggccatcttc
ccgacgcccggcgatgccgactacgcgcacaactacacccaggcgcagccccccgcatgg
ctgaccgcgggtgcagaagccagcggccggttcctgtccgaggtgggcctgcccatgccc
gtcctcaacccggagcacgcactgctgctcagcttcactgccgtgtag

DBGET integrated database retrieval system