KEGG   Arthrobacter sp. FB24: Arth_3427Help
Entry
Arth_3427         CDS       T00421                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
art  Arthrobacter sp. FB24
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:art00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3858754..3859662
Genome map
AA seq 302 aa AA seqDB search
MSSKIILGQNQYGKAEVRVVKITRDTDRHEIEDLNVTSQLRGDFAAAHLQGDNSHVVATD
TQKNTIYAFAREGVGSPEAFLLRLGEHFTSSFDWVTGGRWEAESYSWDRIQAHGAEHDHS
FVRNGQEVRTAVLVRDGAAAHLISGLKDLTVLKSTQSGFVGYPRDKYTTLPETTDRILAT
DVSARWRFNANTDFSALDFNKSYEDVKSLLLEGFTEKYSHALQQTLFDMGAKVLEAHSEI
DEIKFSMPNKHHFLVDLSPFGLDNPNEVFFAADRPYGLIEATVQREDATPADIAWSGIAG
FC
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaaatcatcctcggccagaaccagtacggcaaggccgaagtccgggtcgtc
aagatcaccagggacaccgaccgccacgagatcgaagacctgaacgtcacctcgcagctc
cgcggggacttcgccgccgcgcacctccagggcgacaacagccacgtcgttgccacggac
acgcagaagaacaccatctacgcgtttgcccgtgaaggcgtcggttcgccggaggccttc
ctcctgcgactgggcgagcacttcacctccagcttcgactgggttacgggcggccgctgg
gaagccgagtcctacagctgggatcggatccaggcccatggagccgagcacgaccactcc
ttcgtgcgtaacggccaggaagtccgcactgcggtgctggtccgcgacggcgcggccgct
catctcatctccggcctgaaggacctcaccgtcctcaagtccacccagtccggcttcgtc
ggctacccgcgggacaagtacaccaccctcccggaaaccactgaccgcatcctggctacg
gacgtttccgcccgctggcgcttcaacgccaacacggacttcagcgcgctcgacttcaac
aagagctacgaggacgtcaagagcctgttgctggagggtttcaccgaaaagtactcccac
gccctgcagcagaccctgttcgacatgggcgccaaggtactggaagcgcacagcgagatc
gacgagatcaagttctcgatgcccaacaagcaccacttcctggtggacctctcaccgttc
ggcctcgacaaccccaacgaggtcttctttgccgcggaccgtccgtacggcctgatcgag
gccacggtccagcgcgaggacgccaccccggcggacatcgcctggtccggcatcgccggc
ttctgctag

DBGET integrated database retrieval system