KEGG   Arthrobacter sp. FB24: Arth_3548Help
Entry
Arth_3548         CDS       T00421                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
art  Arthrobacter sp. FB24
Pathway
art00220  Arginine biosynthesis
art00250  Alanine, aspartate and glutamate metabolism
art00471  D-Glutamine and D-glutamate metabolism
art01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Arth_3548
   00220 Arginine biosynthesis
    Arth_3548
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Arth_3548
Enzymes [BR:art01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Arth_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ABK04923
JGI: Arth3548
UniProt: A0K0V3
Position
3987566..3988510
Genome map
AA seq 314 aa AA seqDB search
MKTALDSPPLDLVLDDIVRNHRPRAEAGSVPAGIPHLSSPPFSRFGIAVATSSGEVFSAG
DADVPFSIQSISKVFTLALALSADDPGALWSRVLREPSGTSFNSLVQLEVEHGIPRNPFI
NSGALVVTDHLMDGFPDAAEHLLRFLSREAGRRTGGQGPFIDEEAAKGELANSSRNLALA
HFLKGFGNLRYPAQAVVENYVRQCSIMMTCVETAKAALFLAQDGRGAQGTVVSRSEAKRI
SSIMLTCGMYDAAGEFAYRVGLPGKSGVGGGILAIVPGEGAICVWSPRLDAKGNSLAGTA
ALADLADRTGWSVF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagcactcgactcgccgcctctcgacctggtcctggacgacatcgtgcgaaac
caccggccgcgggccgaagcaggatcggttcccgcaggcatcccccacctctcctccccg
ccgttcagccgcttcggcattgccgtggccacctcgtccggggaagtcttcagcgcgggc
gacgccgacgttcccttctccatccagagcatctccaaggtcttcacgctggccctggca
ctcagcgcggacgaccccggcgcgctctggtcccgggtccttcgcgaaccgtccggcacg
tccttcaactccctggtacagctcgaagtggagcacgggatcccccggaatccgtttatc
aactcgggcgccctggtggtcaccgaccatctcatggacggatttcccgacgccgccgaa
cacctcctgcgcttcctctcccgggaagcgggccgccgcacgggcgggcagggcccgttc
atcgacgaggaagccgcgaagggtgagctggccaacagcagccgaaacctcgccctggcc
cacttcctgaagggcttcggcaacctgcgctaccccgcgcaggcagtagtggaaaactac
gtcaggcagtgctccatcatgatgacctgcgtggagacagcgaaggccgcgctcttcctc
gcgcaggacggccggggcgcgcagggcaccgtggtgtcccggagcgaggccaaacgcatc
agctccatcatgctcacgtgcggaatgtatgacgcggccggcgaatttgcctaccgcgtc
gggcttccggggaagagcggtgtgggtggcggcatcctggcgatcgtgcccggcgaaggg
gccatctgcgtgtggagcccccggctggatgccaaaggcaactccctggccgggactgcc
gccctcgccgatctggccgaccgcaccggatggtctgtgttctaa

DBGET integrated database retrieval system